Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013260157 1150 bp mRNA linear INV 02-SEP-2023 (LOC106093147), mRNA. ACCESSION XM_013260157 VERSION XM_013260157.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013260157.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1150 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1150 /gene="LOC106093147" /note="uncharacterized LOC106093147; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 Proteins" /db_xref="GeneID:106093147" CDS 379..945 /gene="LOC106093147" /codon_start=1 /product="uncharacterized protein LOC106093147" /protein_id="XP_013115611.1" /db_xref="GeneID:106093147" /translation="MKYLTIAIFIVVACIGMGNTRSLKSLYANSVTNYKGQRKPLASP MANGIHDSSYTRSKRQVPEAIKELQDILTRSKQECVKKLRVSSAMANKALMFEENPTE KEKCLMACILEKSELMDKNTNRLSVPAITSFAGKISDNNALVISVAEAAAVNCNNMIK TDRPCEAASQINKCISGAMKAHKLKLVY" misc_feature 607..903 /gene="LOC106093147" /note="pheromone binding protein/general-odorant binding protein (PBP/GOBP) family proteins; Region: PBP_GOBP; cd23992" /db_xref="CDD:467938" misc_feature order(700..702,712..714,730..732,880..882,901..903) /gene="LOC106093147" /note="ligand binding site [chemical binding]; other site" /db_xref="CDD:467938" ORIGIN 1 ttttatgcgt aaaaattgtt aaagtattga gaaagctgat taaatcataa atttgtgaca 61 acaattttat ttgggattgc tttcattcga ctgacaacaa aaacagctga tttgtttatg 121 tttttgtccg gagcaatata gcacgcttta atcgaaaaaa ttacatgggc ttttttcaaa 181 agtaaggttg taatgacctt gaaaatgttt gtctaaattc tgttgctgat acatatgtca 241 tatcagcaag atgcaaatcg agaaagtttt gacacatata aataccatga atgagtgttg 301 gctaagacaa catctcagtt tattcaacta actgataaca actgcagcag ctgacaaacg 361 aacggactga cggacaatat gaaatatttg accatagcaa tctttatagt ggtggcttgc 421 atcggcatgg gcaacaccag aagcttaaaa agcctttatg ccaatagtgt aactaactac 481 aagggccaac gcaaaccttt ggctagtcct atggccaatg gaattcatga cagctcctac 541 accagatcca aacgccaagt acccgaagct ataaaagaac tgcaagatat tttgaccaga 601 tccaagcaag agtgtgttaa gaaattacgt gtcagctctg ccatggccaa caaggctctt 661 atgtttgagg agaatccaac agagaaggaa aaatgtttga tggcctgcat tcttgagaaa 721 tctgaattga tggataagaa caccaacaga ctttctgtac ctgccattac tagcttcgcc 781 ggcaaaatat ctgacaacaa tgctttggtg atttctgtgg ccgaagccgc agccgtcaac 841 tgcaacaaca tgatcaagac cgaccgtcca tgtgaggcag catcccaaat caacaaatgc 901 attagcggtg ctatgaaagc ccataaattg aagctggtct attaaacatg aaccagaacc 961 tttgaacctt tcaacatcat gttttataat taaatttaat cactttttat attttttata 1021 catttttcct atttttataa cataaggtat gcagtcataa taacttgtaa aaagtttgac 1081 actttttaca aaaagtcttt tataaattat catgataaca tgcccacaat tgtgaaatat 1141 atatattttt