Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106093147


LOCUS       XM_013260157            1150 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106093147), mRNA.
ACCESSION   XM_013260157
VERSION     XM_013260157.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013260157.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1150
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1150
                     /gene="LOC106093147"
                     /note="uncharacterized LOC106093147; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 13
                     Proteins"
                     /db_xref="GeneID:106093147"
     CDS             379..945
                     /gene="LOC106093147"
                     /codon_start=1
                     /product="uncharacterized protein LOC106093147"
                     /protein_id="XP_013115611.1"
                     /db_xref="GeneID:106093147"
                     /translation="MKYLTIAIFIVVACIGMGNTRSLKSLYANSVTNYKGQRKPLASP
                     MANGIHDSSYTRSKRQVPEAIKELQDILTRSKQECVKKLRVSSAMANKALMFEENPTE
                     KEKCLMACILEKSELMDKNTNRLSVPAITSFAGKISDNNALVISVAEAAAVNCNNMIK
                     TDRPCEAASQINKCISGAMKAHKLKLVY"
     misc_feature    607..903
                     /gene="LOC106093147"
                     /note="pheromone binding protein/general-odorant binding
                     protein (PBP/GOBP) family proteins; Region: PBP_GOBP;
                     cd23992"
                     /db_xref="CDD:467938"
     misc_feature    order(700..702,712..714,730..732,880..882,901..903)
                     /gene="LOC106093147"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:467938"
ORIGIN      
        1 ttttatgcgt aaaaattgtt aaagtattga gaaagctgat taaatcataa atttgtgaca
       61 acaattttat ttgggattgc tttcattcga ctgacaacaa aaacagctga tttgtttatg
      121 tttttgtccg gagcaatata gcacgcttta atcgaaaaaa ttacatgggc ttttttcaaa
      181 agtaaggttg taatgacctt gaaaatgttt gtctaaattc tgttgctgat acatatgtca
      241 tatcagcaag atgcaaatcg agaaagtttt gacacatata aataccatga atgagtgttg
      301 gctaagacaa catctcagtt tattcaacta actgataaca actgcagcag ctgacaaacg
      361 aacggactga cggacaatat gaaatatttg accatagcaa tctttatagt ggtggcttgc
      421 atcggcatgg gcaacaccag aagcttaaaa agcctttatg ccaatagtgt aactaactac
      481 aagggccaac gcaaaccttt ggctagtcct atggccaatg gaattcatga cagctcctac
      541 accagatcca aacgccaagt acccgaagct ataaaagaac tgcaagatat tttgaccaga
      601 tccaagcaag agtgtgttaa gaaattacgt gtcagctctg ccatggccaa caaggctctt
      661 atgtttgagg agaatccaac agagaaggaa aaatgtttga tggcctgcat tcttgagaaa
      721 tctgaattga tggataagaa caccaacaga ctttctgtac ctgccattac tagcttcgcc
      781 ggcaaaatat ctgacaacaa tgctttggtg atttctgtgg ccgaagccgc agccgtcaac
      841 tgcaacaaca tgatcaagac cgaccgtcca tgtgaggcag catcccaaat caacaaatgc
      901 attagcggtg ctatgaaagc ccataaattg aagctggtct attaaacatg aaccagaacc
      961 tttgaacctt tcaacatcat gttttataat taaatttaat cactttttat attttttata
     1021 catttttcct atttttataa cataaggtat gcagtcataa taacttgtaa aaagtttgac
     1081 actttttaca aaaagtcttt tataaattat catgataaca tgcccacaat tgtgaaatat
     1141 atatattttt