Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013260154 1088 bp mRNA linear INV 02-SEP-2023 transcript variant X5, mRNA. ACCESSION XM_013260154 VERSION XM_013260154.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013260154.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1088 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1088 /gene="LOC106093146" /note="neurocalcin homolog; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 51 Proteins" /db_xref="GeneID:106093146" CDS 410..982 /gene="LOC106093146" /codon_start=1 /product="neurocalcin homolog" /protein_id="XP_013115608.1" /db_xref="GeneID:106093146" /translation="MGKQNSKLKPEVLEDLKQNTEFTDAEIQEWYKGFLKDCPSGHLS VEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREFLCALSVTSRGKLEQKLK WAFSMYDLDGNGYISRQEMLEIVTAIYKMVGSVMKMPEDESTPEKRTDKIFRQMDRNM DGKLSLEEFIEGARSDPSIVRLLQCDPQSH" misc_feature 470..934 /gene="LOC106093146" /note="Ca2+-binding protein, EF-hand superfamily [Signal transduction mechanisms]; Region: FRQ1; COG5126" /db_xref="CDD:444056" polyA_site 1088 /gene="LOC106093146" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cgacatagcg tttaaaatgc acacaatttg tacgtacatg cgtataccca cctaaacgcc 61 gcaagcaacc atttcggaat cgaaagtcgg actctttttt tgccaagatc taataaaact 121 gcataaaaaa atgaacagca gcacagtaat ataaggcatc atctcccatt gagagccaat 181 tcaagtggac gatttctaaa atgccgagga ccatttttgg ggttcgaagg ccctgtggcc 241 tctgcacaaa tcatatcatc atttttttct tccgtgcaca aaattccatc gagtctagaa 301 gtgcaccttt atctgtaatt ttgcaccaga tgtttctaag agcactttca cgaatgacaa 361 tatttcatga tcacgggatt gacggactaa ttgaagatgg aattgtaaaa tgggaaagca 421 aaacagcaaa ttaaagccag aagtgctgga ggatttaaag caaaacactg aattcacaga 481 tgctgaaata caagaatggt acaaaggatt tctgaaagat tgtcccagtg gtcatctatc 541 cgtagaggag ttcaaaaaaa tatatggaaa tttttttcca tatggcgatg ctagcaagtt 601 tgctgaacat gtttttcgca cattcgatgc caatggtgat gggacaatag atttcagaga 661 atttctgtgt gctctcagcg ttacgtctag agggaagtta gaacaaaagc tgaaatgggc 721 tttttctatg tatgacctgg atggaaatgg atatatatca cgacaagaaa tgcttgaaat 781 tgttacggca atatataaaa tggttggatc cgttatgaaa atgcccgaag acgaaagcac 841 gcctgaaaaa cgaactgata aaatatttag acaaatggat cgtaacatgg atgggaaact 901 tagcttagag gagtttatag aaggtgcaag aagtgatcca tcgattgtac gcttattaca 961 atgtgatccc caatcccatt aactcttata tatttatggt ttaagtaagc aataaatgtt 1021 cggattatta taaaagcaac aatatttttt ctaattgcaa taaaagaaaa cttgagaata 1081 ccacaaaa