Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013260153 945 bp mRNA linear INV 02-SEP-2023 transcript variant X4, mRNA. ACCESSION XM_013260153 VERSION XM_013260153.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013260153.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..945 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..945 /gene="LOC106093146" /note="neurocalcin homolog; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 51 Proteins" /db_xref="GeneID:106093146" CDS 267..839 /gene="LOC106093146" /codon_start=1 /product="neurocalcin homolog" /protein_id="XP_013115607.1" /db_xref="GeneID:106093146" /translation="MGKQNSKLKPEVLEDLKQNTEFTDAEIQEWYKGFLKDCPSGHLS VEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREFLCALSVTSRGKLEQKLK WAFSMYDLDGNGYISRQEMLEIVTAIYKMVGSVMKMPEDESTPEKRTDKIFRQMDRNM DGKLSLEEFIEGARSDPSIVRLLQCDPQSH" misc_feature 327..791 /gene="LOC106093146" /note="Ca2+-binding protein, EF-hand superfamily [Signal transduction mechanisms]; Region: FRQ1; COG5126" /db_xref="CDD:444056" polyA_site 945 /gene="LOC106093146" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cgtgcaagtc gccaaaaaac actgcaacct ttgtgttttt ttcacttgtc acacagcaaa 61 aattaagaaa tccacataaa taaatcttga gaatcgattg aactgcgggt tttgtttttg 121 tttgtacttt cacacattct actgacaatc aatccggtgc cattgaccgc tgtttcctca 181 gctgtcagta gcccctcccc ccatttaaca tctttcatta ttggatacat gtggacctag 241 gaggctagtt ggtaacttgt aataaaatgg gaaagcaaaa cagcaaatta aagccagaag 301 tgctggagga tttaaagcaa aacactgaat tcacagatgc tgaaatacaa gaatggtaca 361 aaggatttct gaaagattgt cccagtggtc atctatccgt agaggagttc aaaaaaatat 421 atggaaattt ttttccatat ggcgatgcta gcaagtttgc tgaacatgtt tttcgcacat 481 tcgatgccaa tggtgatggg acaatagatt tcagagaatt tctgtgtgct ctcagcgtta 541 cgtctagagg gaagttagaa caaaagctga aatgggcttt ttctatgtat gacctggatg 601 gaaatggata tatatcacga caagaaatgc ttgaaattgt tacggcaata tataaaatgg 661 ttggatccgt tatgaaaatg cccgaagacg aaagcacgcc tgaaaaacga actgataaaa 721 tatttagaca aatggatcgt aacatggatg ggaaacttag cttagaggag tttatagaag 781 gtgcaagaag tgatccatcg attgtacgct tattacaatg tgatccccaa tcccattaac 841 tcttatatat ttatggttta agtaagcaat aaatgttcgg attattataa aagcaacaat 901 attttttcta attgcaataa aagaaaactt gagaatacca caaaa