Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013260152 981 bp mRNA linear INV 02-SEP-2023 transcript variant X3, mRNA. ACCESSION XM_013260152 VERSION XM_013260152.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013260152.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..981 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..981 /gene="LOC106093146" /note="neurocalcin homolog; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 51 Proteins" /db_xref="GeneID:106093146" CDS 303..875 /gene="LOC106093146" /codon_start=1 /product="neurocalcin homolog" /protein_id="XP_013115606.1" /db_xref="GeneID:106093146" /translation="MGKQNSKLKPEVLEDLKQNTEFTDAEIQEWYKGFLKDCPSGHLS VEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREFLCALSVTSRGKLEQKLK WAFSMYDLDGNGYISRQEMLEIVTAIYKMVGSVMKMPEDESTPEKRTDKIFRQMDRNM DGKLSLEEFIEGARSDPSIVRLLQCDPQSH" misc_feature 363..827 /gene="LOC106093146" /note="Ca2+-binding protein, EF-hand superfamily [Signal transduction mechanisms]; Region: FRQ1; COG5126" /db_xref="CDD:444056" polyA_site 981 /gene="LOC106093146" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gtgcaagtcg ccaaaaaaca ctgcaacctt tgtgtttttt tcacttgtca cacagcaaaa 61 attaagaaat ccacataaat aaatcttgag aaaacggcct ttgtttttta tgtctattgg 121 cagaatcgat tgaactgcgg gttttgtttt tgtttgtact ttcacacatt ctactgacaa 181 tcaatccggt gccattgacc gctgtttcct cagctgtcag tagcccctcc ccccatttaa 241 catctttcat tattggatac atgtggacct aggaggctag ttggtaactt gtaatgtaga 301 aaatgggaaa gcaaaacagc aaattaaagc cagaagtgct ggaggattta aagcaaaaca 361 ctgaattcac agatgctgaa atacaagaat ggtacaaagg atttctgaaa gattgtccca 421 gtggtcatct atccgtagag gagttcaaaa aaatatatgg aaattttttt ccatatggcg 481 atgctagcaa gtttgctgaa catgtttttc gcacattcga tgccaatggt gatgggacaa 541 tagatttcag agaatttctg tgtgctctca gcgttacgtc tagagggaag ttagaacaaa 601 agctgaaatg ggctttttct atgtatgacc tggatggaaa tggatatata tcacgacaag 661 aaatgcttga aattgttacg gcaatatata aaatggttgg atccgttatg aaaatgcccg 721 aagacgaaag cacgcctgaa aaacgaactg ataaaatatt tagacaaatg gatcgtaaca 781 tggatgggaa acttagctta gaggagttta tagaaggtgc aagaagtgat ccatcgattg 841 tacgcttatt acaatgtgat ccccaatccc attaactctt atatatttat ggtttaagta 901 agcaataaat gttcggatta ttataaaagc aacaatattt tttctaattg caataaaaga 961 aaacttgaga ataccacaaa a