Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans neurocalcin homolog (LOC106093146),


LOCUS       XM_013260152             981 bp    mRNA    linear   INV 02-SEP-2023
            transcript variant X3, mRNA.
ACCESSION   XM_013260152
VERSION     XM_013260152.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013260152.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..981
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..981
                     /gene="LOC106093146"
                     /note="neurocalcin homolog; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 51
                     Proteins"
                     /db_xref="GeneID:106093146"
     CDS             303..875
                     /gene="LOC106093146"
                     /codon_start=1
                     /product="neurocalcin homolog"
                     /protein_id="XP_013115606.1"
                     /db_xref="GeneID:106093146"
                     /translation="MGKQNSKLKPEVLEDLKQNTEFTDAEIQEWYKGFLKDCPSGHLS
                     VEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREFLCALSVTSRGKLEQKLK
                     WAFSMYDLDGNGYISRQEMLEIVTAIYKMVGSVMKMPEDESTPEKRTDKIFRQMDRNM
                     DGKLSLEEFIEGARSDPSIVRLLQCDPQSH"
     misc_feature    363..827
                     /gene="LOC106093146"
                     /note="Ca2+-binding protein, EF-hand superfamily [Signal
                     transduction mechanisms]; Region: FRQ1; COG5126"
                     /db_xref="CDD:444056"
     polyA_site      981
                     /gene="LOC106093146"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gtgcaagtcg ccaaaaaaca ctgcaacctt tgtgtttttt tcacttgtca cacagcaaaa
       61 attaagaaat ccacataaat aaatcttgag aaaacggcct ttgtttttta tgtctattgg
      121 cagaatcgat tgaactgcgg gttttgtttt tgtttgtact ttcacacatt ctactgacaa
      181 tcaatccggt gccattgacc gctgtttcct cagctgtcag tagcccctcc ccccatttaa
      241 catctttcat tattggatac atgtggacct aggaggctag ttggtaactt gtaatgtaga
      301 aaatgggaaa gcaaaacagc aaattaaagc cagaagtgct ggaggattta aagcaaaaca
      361 ctgaattcac agatgctgaa atacaagaat ggtacaaagg atttctgaaa gattgtccca
      421 gtggtcatct atccgtagag gagttcaaaa aaatatatgg aaattttttt ccatatggcg
      481 atgctagcaa gtttgctgaa catgtttttc gcacattcga tgccaatggt gatgggacaa
      541 tagatttcag agaatttctg tgtgctctca gcgttacgtc tagagggaag ttagaacaaa
      601 agctgaaatg ggctttttct atgtatgacc tggatggaaa tggatatata tcacgacaag
      661 aaatgcttga aattgttacg gcaatatata aaatggttgg atccgttatg aaaatgcccg
      721 aagacgaaag cacgcctgaa aaacgaactg ataaaatatt tagacaaatg gatcgtaaca
      781 tggatgggaa acttagctta gaggagttta tagaaggtgc aagaagtgat ccatcgattg
      841 tacgcttatt acaatgtgat ccccaatccc attaactctt atatatttat ggtttaagta
      901 agcaataaat gttcggatta ttataaaagc aacaatattt tttctaattg caataaaaga
      961 aaacttgaga ataccacaaa a