Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans neurocalcin homolog (LOC106093146),


LOCUS       XM_013260151             949 bp    mRNA    linear   INV 02-SEP-2023
            transcript variant X2, mRNA.
ACCESSION   XM_013260151
VERSION     XM_013260151.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013260151.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..949
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..949
                     /gene="LOC106093146"
                     /note="neurocalcin homolog; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 51
                     Proteins"
                     /db_xref="GeneID:106093146"
     CDS             271..843
                     /gene="LOC106093146"
                     /codon_start=1
                     /product="neurocalcin homolog"
                     /protein_id="XP_013115605.1"
                     /db_xref="GeneID:106093146"
                     /translation="MGKQNSKLKPEVLEDLKQNTEFTDAEIQEWYKGFLKDCPSGHLS
                     VEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREFLCALSVTSRGKLEQKLK
                     WAFSMYDLDGNGYISRQEMLEIVTAIYKMVGSVMKMPEDESTPEKRTDKIFRQMDRNM
                     DGKLSLEEFIEGARSDPSIVRLLQCDPQSH"
     misc_feature    331..795
                     /gene="LOC106093146"
                     /note="Ca2+-binding protein, EF-hand superfamily [Signal
                     transduction mechanisms]; Region: FRQ1; COG5126"
                     /db_xref="CDD:444056"
     polyA_site      949
                     /gene="LOC106093146"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cgtgcaagtc gccaaaaaac actgcaacct ttgtgttttt ttcacttgtc acacagcaaa
       61 aattaagaaa tccacataaa taaatcttga gaatcgattg aactgcgggt tttgtttttg
      121 tttgtacttt cacacattct actgacaatc aatccggtgc cattgaccgc tgtttcctca
      181 gctgtcagta gcccctcccc ccatttaaca tctttcatta ttggatacat gtggacctag
      241 gaggctagtt ggtaacttgt aatgtagaaa atgggaaagc aaaacagcaa attaaagcca
      301 gaagtgctgg aggatttaaa gcaaaacact gaattcacag atgctgaaat acaagaatgg
      361 tacaaaggat ttctgaaaga ttgtcccagt ggtcatctat ccgtagagga gttcaaaaaa
      421 atatatggaa atttttttcc atatggcgat gctagcaagt ttgctgaaca tgtttttcgc
      481 acattcgatg ccaatggtga tgggacaata gatttcagag aatttctgtg tgctctcagc
      541 gttacgtcta gagggaagtt agaacaaaag ctgaaatggg ctttttctat gtatgacctg
      601 gatggaaatg gatatatatc acgacaagaa atgcttgaaa ttgttacggc aatatataaa
      661 atggttggat ccgttatgaa aatgcccgaa gacgaaagca cgcctgaaaa acgaactgat
      721 aaaatattta gacaaatgga tcgtaacatg gatgggaaac ttagcttaga ggagtttata
      781 gaaggtgcaa gaagtgatcc atcgattgta cgcttattac aatgtgatcc ccaatcccat
      841 taactcttat atatttatgg tttaagtaag caataaatgt tcggattatt ataaaagcaa
      901 caatattttt tctaattgca ataaaagaaa acttgagaat accacaaaa