Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013260151 949 bp mRNA linear INV 02-SEP-2023 transcript variant X2, mRNA. ACCESSION XM_013260151 VERSION XM_013260151.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013260151.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..949 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..949 /gene="LOC106093146" /note="neurocalcin homolog; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 51 Proteins" /db_xref="GeneID:106093146" CDS 271..843 /gene="LOC106093146" /codon_start=1 /product="neurocalcin homolog" /protein_id="XP_013115605.1" /db_xref="GeneID:106093146" /translation="MGKQNSKLKPEVLEDLKQNTEFTDAEIQEWYKGFLKDCPSGHLS VEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREFLCALSVTSRGKLEQKLK WAFSMYDLDGNGYISRQEMLEIVTAIYKMVGSVMKMPEDESTPEKRTDKIFRQMDRNM DGKLSLEEFIEGARSDPSIVRLLQCDPQSH" misc_feature 331..795 /gene="LOC106093146" /note="Ca2+-binding protein, EF-hand superfamily [Signal transduction mechanisms]; Region: FRQ1; COG5126" /db_xref="CDD:444056" polyA_site 949 /gene="LOC106093146" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cgtgcaagtc gccaaaaaac actgcaacct ttgtgttttt ttcacttgtc acacagcaaa 61 aattaagaaa tccacataaa taaatcttga gaatcgattg aactgcgggt tttgtttttg 121 tttgtacttt cacacattct actgacaatc aatccggtgc cattgaccgc tgtttcctca 181 gctgtcagta gcccctcccc ccatttaaca tctttcatta ttggatacat gtggacctag 241 gaggctagtt ggtaacttgt aatgtagaaa atgggaaagc aaaacagcaa attaaagcca 301 gaagtgctgg aggatttaaa gcaaaacact gaattcacag atgctgaaat acaagaatgg 361 tacaaaggat ttctgaaaga ttgtcccagt ggtcatctat ccgtagagga gttcaaaaaa 421 atatatggaa atttttttcc atatggcgat gctagcaagt ttgctgaaca tgtttttcgc 481 acattcgatg ccaatggtga tgggacaata gatttcagag aatttctgtg tgctctcagc 541 gttacgtcta gagggaagtt agaacaaaag ctgaaatggg ctttttctat gtatgacctg 601 gatggaaatg gatatatatc acgacaagaa atgcttgaaa ttgttacggc aatatataaa 661 atggttggat ccgttatgaa aatgcccgaa gacgaaagca cgcctgaaaa acgaactgat 721 aaaatattta gacaaatgga tcgtaacatg gatgggaaac ttagcttaga ggagtttata 781 gaaggtgcaa gaagtgatcc atcgattgta cgcttattac aatgtgatcc ccaatcccat 841 taactcttat atatttatgg tttaagtaag caataaatgt tcggattatt ataaaagcaa 901 caatattttt tctaattgca ataaaagaaa acttgagaat accacaaaa