Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans neurocalcin homolog (LOC106093146),


LOCUS       XM_013260149             772 bp    mRNA    linear   INV 02-SEP-2023
            transcript variant X1, mRNA.
ACCESSION   XM_013260149
VERSION     XM_013260149.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013260149.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..772
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..772
                     /gene="LOC106093146"
                     /note="neurocalcin homolog; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 51
                     Proteins"
                     /db_xref="GeneID:106093146"
     CDS             94..666
                     /gene="LOC106093146"
                     /codon_start=1
                     /product="neurocalcin homolog"
                     /protein_id="XP_013115603.1"
                     /db_xref="GeneID:106093146"
                     /translation="MGKQNSKLKPEVLEDLKQNTEFTDAEIQEWYKGFLKDCPSGHLS
                     VEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREFLCALSVTSRGKLEQKLK
                     WAFSMYDLDGNGYISRQEMLEIVTAIYKMVGSVMKMPEDESTPEKRTDKIFRQMDRNM
                     DGKLSLEEFIEGARSDPSIVRLLQCDPQSH"
     misc_feature    154..618
                     /gene="LOC106093146"
                     /note="Ca2+-binding protein, EF-hand superfamily [Signal
                     transduction mechanisms]; Region: FRQ1; COG5126"
                     /db_xref="CDD:444056"
     polyA_site      772
                     /gene="LOC106093146"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gtgcaagtcg ccaaaaaaca ctgcaacctt tgtgtttttt tcacttgtca cacagcaaaa
       61 attaagaaat ccacataaat aaatcttgag aaaatgggaa agcaaaacag caaattaaag
      121 ccagaagtgc tggaggattt aaagcaaaac actgaattca cagatgctga aatacaagaa
      181 tggtacaaag gatttctgaa agattgtccc agtggtcatc tatccgtaga ggagttcaaa
      241 aaaatatatg gaaatttttt tccatatggc gatgctagca agtttgctga acatgttttt
      301 cgcacattcg atgccaatgg tgatgggaca atagatttca gagaatttct gtgtgctctc
      361 agcgttacgt ctagagggaa gttagaacaa aagctgaaat gggctttttc tatgtatgac
      421 ctggatggaa atggatatat atcacgacaa gaaatgcttg aaattgttac ggcaatatat
      481 aaaatggttg gatccgttat gaaaatgccc gaagacgaaa gcacgcctga aaaacgaact
      541 gataaaatat ttagacaaat ggatcgtaac atggatggga aacttagctt agaggagttt
      601 atagaaggtg caagaagtga tccatcgatt gtacgcttat tacaatgtga tccccaatcc
      661 cattaactct tatatattta tggtttaagt aagcaataaa tgttcggatt attataaaag
      721 caacaatatt ttttctaatt gcaataaaag aaaacttgag aataccacaa aa