Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013260149 772 bp mRNA linear INV 02-SEP-2023 transcript variant X1, mRNA. ACCESSION XM_013260149 VERSION XM_013260149.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013260149.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..772 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..772 /gene="LOC106093146" /note="neurocalcin homolog; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 51 Proteins" /db_xref="GeneID:106093146" CDS 94..666 /gene="LOC106093146" /codon_start=1 /product="neurocalcin homolog" /protein_id="XP_013115603.1" /db_xref="GeneID:106093146" /translation="MGKQNSKLKPEVLEDLKQNTEFTDAEIQEWYKGFLKDCPSGHLS VEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREFLCALSVTSRGKLEQKLK WAFSMYDLDGNGYISRQEMLEIVTAIYKMVGSVMKMPEDESTPEKRTDKIFRQMDRNM DGKLSLEEFIEGARSDPSIVRLLQCDPQSH" misc_feature 154..618 /gene="LOC106093146" /note="Ca2+-binding protein, EF-hand superfamily [Signal transduction mechanisms]; Region: FRQ1; COG5126" /db_xref="CDD:444056" polyA_site 772 /gene="LOC106093146" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gtgcaagtcg ccaaaaaaca ctgcaacctt tgtgtttttt tcacttgtca cacagcaaaa 61 attaagaaat ccacataaat aaatcttgag aaaatgggaa agcaaaacag caaattaaag 121 ccagaagtgc tggaggattt aaagcaaaac actgaattca cagatgctga aatacaagaa 181 tggtacaaag gatttctgaa agattgtccc agtggtcatc tatccgtaga ggagttcaaa 241 aaaatatatg gaaatttttt tccatatggc gatgctagca agtttgctga acatgttttt 301 cgcacattcg atgccaatgg tgatgggaca atagatttca gagaatttct gtgtgctctc 361 agcgttacgt ctagagggaa gttagaacaa aagctgaaat gggctttttc tatgtatgac 421 ctggatggaa atggatatat atcacgacaa gaaatgcttg aaattgttac ggcaatatat 481 aaaatggttg gatccgttat gaaaatgccc gaagacgaaa gcacgcctga aaaacgaact 541 gataaaatat ttagacaaat ggatcgtaac atggatggga aacttagctt agaggagttt 601 atagaaggtg caagaagtga tccatcgatt gtacgcttat tacaatgtga tccccaatcc 661 cattaactct tatatattta tggtttaagt aagcaataaa tgttcggatt attataaaag 721 caacaatatt ttttctaatt gcaataaaag aaaacttgag aataccacaa aa