Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans 3-oxoacyl-[acyl-carrier-protein]


LOCUS       XM_013260140            1011 bp    mRNA    linear   INV 02-SEP-2023
            reductase FabG (LOC106093138), mRNA.
ACCESSION   XM_013260140
VERSION     XM_013260140.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013260140.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1011
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1011
                     /gene="LOC106093138"
                     /note="3-oxoacyl-[acyl-carrier-protein] reductase FabG;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 33 Proteins"
                     /db_xref="GeneID:106093138"
     CDS             171..941
                     /gene="LOC106093138"
                     /codon_start=1
                     /product="3-oxoacyl-[acyl-carrier-protein] reductase FabG"
                     /protein_id="XP_013115594.2"
                     /db_xref="GeneID:106093138"
                     /translation="MDFVGKVALITGASSGIGAATAETFAKYGANLALVGRNVNKLNE
                     TENKCKQINSNINCLSVVADVTTDSEKILNACIGNFQRLDVLVNNAGILAGGSLMDID
                     LEQFDNVLNTNLRAVFSITKLSLPYLINAQGNIVNVSSVAGQRSFPDTFSYCISKAAL
                     DQFTKCLSLDLASKNVRVNSVNPGVVITDIHKTCLGMSEKDYAEYLEICKGTHAMGRV
                     GNAFEVAETIAFLASGQASFITGALLPVDGGRHAMCPR"
     polyA_site      1011
                     /gene="LOC106093138"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tgatagcaag cagcacaaag agctttgtgc agagcaattg cactctgatc aatttccaat
       61 ggtgatgaaa catctgttga ctttggaaat tctaccgatc aaccggccac tgaaagcaca
      121 acaatcacaa acgaaaagca aaagcaaaat gttgcagttt agtcggaaat atggatttcg
      181 tcggtaaagt tgcattgata acaggtgcta gttcgggtat aggtgctgct accgccgaaa
      241 cttttgcaaa atacggagca aatctggcac tggtcggacg taatgtgaac aaactcaacg
      301 aaactgaaaa caaatgcaag cagattaact ccaatatcaa ttgtttatct gtggtggctg
      361 atgtcaccac cgattcggaa aaaatcttaa atgcttgtat aggaaatttt caacgactgg
      421 atgtgttggt taacaatgct ggaattttgg ctgggggcag ccttatggac atcgatttgg
      481 aacaattcga taatgtactc aacacaaatt tgcgtgccgt attttccata acaaaattgt
      541 ctctacccta tctcatcaat gcccaaggta acattgtgaa tgtgtccagt gttgctggtc
      601 aacgctcatt tccggatact tttagttatt gtatatctaa ggcagcattg gatcaattta
      661 ccaaatgtct ttcattggat ttggcctcca agaatgttcg agtcaactcc gtcaatcctg
      721 gagtggtgat aacggatatt cacaaaactt gtcttgggat gtcagaaaaa gattatgccg
      781 aatatttgga gatttgtaaa ggcacccatg ctatgggtag agttggtaat gcctttgaag
      841 tggccgaaac gatagctttt ctggccagtg gtcaggctag tttcataacc ggtgcccttc
      901 ttccagttga tggtggtaga catgccatgt gcccacgata gattaaattc tctttagtta
      961 agtaattttt tgtgaagtga aataaatatg acaataaatc tattgcttct a