Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013260140 1011 bp mRNA linear INV 02-SEP-2023 reductase FabG (LOC106093138), mRNA. ACCESSION XM_013260140 VERSION XM_013260140.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013260140.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1011 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1011 /gene="LOC106093138" /note="3-oxoacyl-[acyl-carrier-protein] reductase FabG; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 33 Proteins" /db_xref="GeneID:106093138" CDS 171..941 /gene="LOC106093138" /codon_start=1 /product="3-oxoacyl-[acyl-carrier-protein] reductase FabG" /protein_id="XP_013115594.2" /db_xref="GeneID:106093138" /translation="MDFVGKVALITGASSGIGAATAETFAKYGANLALVGRNVNKLNE TENKCKQINSNINCLSVVADVTTDSEKILNACIGNFQRLDVLVNNAGILAGGSLMDID LEQFDNVLNTNLRAVFSITKLSLPYLINAQGNIVNVSSVAGQRSFPDTFSYCISKAAL DQFTKCLSLDLASKNVRVNSVNPGVVITDIHKTCLGMSEKDYAEYLEICKGTHAMGRV GNAFEVAETIAFLASGQASFITGALLPVDGGRHAMCPR" polyA_site 1011 /gene="LOC106093138" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tgatagcaag cagcacaaag agctttgtgc agagcaattg cactctgatc aatttccaat 61 ggtgatgaaa catctgttga ctttggaaat tctaccgatc aaccggccac tgaaagcaca 121 acaatcacaa acgaaaagca aaagcaaaat gttgcagttt agtcggaaat atggatttcg 181 tcggtaaagt tgcattgata acaggtgcta gttcgggtat aggtgctgct accgccgaaa 241 cttttgcaaa atacggagca aatctggcac tggtcggacg taatgtgaac aaactcaacg 301 aaactgaaaa caaatgcaag cagattaact ccaatatcaa ttgtttatct gtggtggctg 361 atgtcaccac cgattcggaa aaaatcttaa atgcttgtat aggaaatttt caacgactgg 421 atgtgttggt taacaatgct ggaattttgg ctgggggcag ccttatggac atcgatttgg 481 aacaattcga taatgtactc aacacaaatt tgcgtgccgt attttccata acaaaattgt 541 ctctacccta tctcatcaat gcccaaggta acattgtgaa tgtgtccagt gttgctggtc 601 aacgctcatt tccggatact tttagttatt gtatatctaa ggcagcattg gatcaattta 661 ccaaatgtct ttcattggat ttggcctcca agaatgttcg agtcaactcc gtcaatcctg 721 gagtggtgat aacggatatt cacaaaactt gtcttgggat gtcagaaaaa gattatgccg 781 aatatttgga gatttgtaaa ggcacccatg ctatgggtag agttggtaat gcctttgaag 841 tggccgaaac gatagctttt ctggccagtg gtcaggctag tttcataacc ggtgcccttc 901 ttccagttga tggtggtaga catgccatgt gcccacgata gattaaattc tctttagtta 961 agtaattttt tgtgaagtga aataaatatg acaataaatc tattgcttct a