Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013260137 681 bp mRNA linear INV 02-SEP-2023 ACCESSION XM_013260137 VERSION XM_013260137.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013260137.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..681 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..681 /gene="LOC106093135" /note="protein bcn92; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:106093135" CDS 188..466 /gene="LOC106093135" /codon_start=1 /product="protein bcn92" /protein_id="XP_013115591.1" /db_xref="GeneID:106093135" /translation="MSTRRLAKTLYRKLLREAEKLPSYNFRMYAGRKIRETFRENKTI NDFDKIDAQIEVARQSLEMLRRQAIIGHLYSAEKLVIERKKTLSHAED" misc_feature 206..409 /gene="LOC106093135" /note="LYR (leucine-tyrosine-arginine) motif found in LYR motif-containing protein 4 (LYRM4) and similar proteins; Region: Complex1_LYR_LYRM4; cd20264" /db_xref="CDD:380759" misc_feature order(206..211,284..289,296..301,308..313,335..337, 344..346,365..367,377..379) /gene="LOC106093135" /note="phosphopantetheine binding site [chemical binding]; other site" /db_xref="CDD:380759" misc_feature order(209..211,218..223,230..235,257..265,269..274, 281..286,290..295,302..304,311..313,374..376,383..388, 395..397) /gene="LOC106093135" /note="trimer interface [polypeptide binding]; other site" /db_xref="CDD:380759" polyA_site 681 /gene="LOC106093135" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 acagctgatt gtcatttagt ttttttcttt gattgggtaa tttatttatt ttgagtattt 61 aatcggcatt ctgcatgcag tatttgccgc ctagtagtat acggataact gaaaaatttc 121 acggtggttt aattaaaaac atagcaaact tcatcacttc tcgaaattaa ttactcccaa 181 catcataatg tctacacgtc gtctggccaa aactttatac cgcaaattat tgcgtgaagc 241 tgaaaaatta ccatcatata acttcagaat gtatgctgga aggaagattc gtgaaacatt 301 ccgtgaaaac aaaacgataa atgattttga caaaattgat gcacaaattg aggtggcaag 361 gcagagtctt gaaatgttac gacgacaggc tatcattgga catctatact ctgcagaaaa 421 actagttata gaaaggaaga aaaccctaag ccatgcagaa gattaaaaaa aacgaattcc 481 agcgttaaga atgagaacac gaaagacggt tatgcaggca ttctacgagg agtactggtt 541 acgaataatt agtttctagg gctgttttca gtttttcttt gcattttatg agtttcgttt 601 ttaagaaatg gaaagaagat gaacacaaat tgtttttaaa ataagttacc aagtgaataa 661 aacaagaata aaattcttta a