Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans sex peptide receptor (LOC106093072),


LOCUS       XM_013260053            1536 bp    mRNA    linear   INV 02-SEP-2023
            mRNA.
ACCESSION   XM_013260053
VERSION     XM_013260053.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013260053.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1536
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1536
                     /gene="LOC106093072"
                     /note="sex peptide receptor; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 22
                     Proteins"
                     /db_xref="GeneID:106093072"
     CDS             1..1533
                     /gene="LOC106093072"
                     /codon_start=1
                     /product="sex peptide receptor"
                     /protein_id="XP_013115507.2"
                     /db_xref="GeneID:106093072"
                     /translation="MVLRDSMRQHQNMNNLQQTMIAVVTESVAAVMAPTMNDNNLYHR
                     TSVPANASTSPADSSTHGANNHTEYSYDISAAGLLYWSGDGGGGGVNGVAELGSDNSI
                     ARDSSSEIIIDSLSNSFEYLNASAYAHDSNDTDFYMHCMDRDPVTNLSYFNLTCETQI
                     EYVLPLYGYIMPFLLVLTVVSNSLIVLILSKKNMSTPTNFVLMGMAIFDMLTVIFPAP
                     GLIYMYTFGNHYKPLHPTSLCRAYIIFVDILPAICHTASIWLTLALAVQRYIYVCHAP
                     MARTWCTIPRVKRCTLYIAIAAFLHQSTRMIDRSYEPLTIEWNGEMVEVCHLETADWV
                     HELIGEDLYFSTFYLFRVFFVNLLPCVMLVTLNILLFSAMRKAQERRKLLFSENRKKE
                     CKKLRESNCTTLMLIVVVSVFLAVEIPIAVVTVMHIVSSLAYQFLDYSIANVFVTATN
                     FALVVSYPINFGIYCGMSRQFRETFKSIFLGRMVGKKDNSSRYSIVNGPRTCTNTNET
                     VL"
ORIGIN      
        1 atggtccttc gcgatagtat gcgccagcat cagaacatga ataacctaca acagaccatg
       61 atagccgtag tgacagagtc cgtggctgca gttatggcac ccaccatgaa tgataataac
      121 ctctaccatc gaaccagcgt acctgcgaat gcatcgacaa gtcctgctga cagcagcaca
      181 catggtgcca acaatcacac cgaatattcc tatgacatct ccgccgcggg tcttttgtat
      241 tggagtggtg atgggggcgg tggaggtgtt aatggcgtag ctgaacttgg ctccgacaac
      301 tccattgcca gagatagtag cagtgaaatc atcattgata gccttagcaa ttcatttgaa
      361 tatttgaatg cgtccgcata tgcccatgat tccaatgata cagattttta catgcactgc
      421 atggacagag atcccgttac gaatctatcg tatttcaatc tcacgtgtga gacgcagata
      481 gaatatgttc tgccactgta cggttatata atgccatttt tgttagtgct aactgtggtg
      541 tccaattcct tgattgtgct gatactgagc aaaaagaata tgtcaacgcc gactaatttt
      601 gtactaatgg gtatggccat atttgatatg ctgacggtaa tatttccggc tcctggtctc
      661 atctacatgt acacgtttgg caatcactac aagcccctgc atccgacgag cctctgtcga
      721 gcctacataa tattcgtcga tattttgcct gcaatctgtc acacagcgtc aatttggttg
      781 acattggcgt tggccgtaca aagatacatc tacgtgtgtc acgctcccat ggcgcggaca
      841 tggtgtacaa tacctcgcgt caaacgctgc actctgtata tagccatagc agcatttctg
      901 catcaaagta ctcgcatgat tgatcgttcc tatgagccac tgacgatcga gtggaatggt
      961 gaaatggtcg aggtgtgtca tctggaaacg gccgattggg tacacgagct tatcggcgaa
     1021 gacctttact tctcgacatt ctatctgttt cgagttttct ttgttaactt gttgccttgt
     1081 gtcatgttgg tcacactgaa tattctccta ttctcggcta tgcgtaaagc gcaggaacga
     1141 agaaaacttc tatttagcga aaatcgcaaa aaggaatgca aaaagctgcg agagagcaat
     1201 tgcaccacac taatgctgat tgtggtggtc tctgtgtttc tggccgtgga aattcccata
     1261 gctgtggtca cagttatgca cattgtgtcc tccctggctt atcagtttct ggactacagc
     1321 atcgccaatg tctttgtgac ggctacgaat tttgctctgg tcgtcagtta tcctattaat
     1381 ttcggtatct actgtggcat gtcaaggcag ttccgagaaa ctttcaaatc catcttcctg
     1441 ggacgtatgg tgggcaaaaa ggacaattcg tcacgttact ccattgtaaa tggaccacgc
     1501 acctgcacca acaccaacga gacagtcctc tagtaa