PREDICTED: Stomoxys calcitrans uncharacterized LOC106093050

LOCUS       XM_013260028             640 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106093050), mRNA.
ACCESSION   XM_013260028
VERSION     XM_013260028.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013260028.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..640
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..640
                     /gene="LOC106093050"
                     /note="uncharacterized LOC106093050; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106093050"
     CDS             1..531
                     /gene="LOC106093050"
                     /codon_start=1
                     /product="uncharacterized protein LOC106093050"
                     /protein_id="XP_013115482.1"
                     /db_xref="GeneID:106093050"
                     /translation="MDITDPQKKLNILIERCQEISQEIGNILKDKKENLEKQAQLKKN
                     LQDVQEKVEAAHVEEAALEDRIQAAVGGPNENGRDFVQKMCLLLGYQMSNCRLLPSPN
                     GGVQRKLLYASNCSVTYNEFNRMLYELVDVHPPHPEFAEIRQFLQDSQDLKGLLTSLK
                     KFFDQITTENSENEIL"
     misc_feature    4..>207
                     /gene="LOC106093050"
                     /note="Uncharacterized N-terminal coiled-coil domain of
                     peptidoglycan hydrolase CwlO [Function unknown]; Region:
                     CwlO1; COG3883"
                     /db_xref="CDD:443091"
     polyA_site      640
                     /gene="LOC106093050"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 atggatatca cagatcctca gaaaaaatta aatatactaa ttgaacgctg ccaagaaata
       61 agccaggaga taggaaatat tcttaaagat aaaaaagaaa atttagaaaa gcaagcacag
      121 ctgaaaaaaa atctgcaaga tgtgcaagaa aaagttgaag ccgcccatgt ggaggaagcc
      181 gccttggagg atagaataca agctgccgta ggtggtccaa acgaaaacgg aagagatttt
      241 gttcaaaaaa tgtgtctttt gctaggttac caaatgtcca attgtcgact tttgccctcg
      301 ccaaatggcg gtgttcaaag aaagcttttg tatgcaagta attgtagtgt tacctacaat
      361 gaatttaatc gaatgttgta tgagctcgtt gacgtgcatc cgcctcatcc ggaatttgca
      421 gagattcgac aattcttgca agattcgcaa gacttaaaag gtttgttgac aagtttaaaa
      481 aagtttttcg atcaaattac aacggagaat agtgagaacg aaattttata aaattttcca
      541 accaaggcct gtatacagaa tatactgttt ttttatgaag tactgaagaa aatatctgga
      601 actattctta aagtaaaaat aacacctata cgaatctaaa