Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans probable serine/threonine-protein


LOCUS       XM_013259980            1612 bp    mRNA    linear   INV 02-SEP-2023
            kinase cdc7 (LOC106093010), partial mRNA.
ACCESSION   XM_013259980
VERSION     XM_013259980.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; corrected model.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) and transcript sequence (GDIM01037487.1) annotated
            using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013259980.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            assembly gap :: added 438 transcript bases to patch genome assembly
                            gap
            ##RefSeq-Attributes-END##
            COMPLETENESS: incomplete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-857               OY720438.1         3691980-3692836
            858-1080            OY720438.1         3693789-3694011
            1081-1174           OY720438.1         3698673-3698766
            1175-1612           GDIM01037487.1     718-1155
FEATURES             Location/Qualifiers
     source          1..1612
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..>1612
                     /gene="LOC106093010"
                     /note="probable serine/threonine-protein kinase cdc7; The
                     sequence of the model RefSeq transcript was modified
                     relative to its source genomic sequence to represent the
                     inferred CDS: added 438 bases not found in genome
                     assembly; Derived by automated computational analysis
                     using gene prediction method: Gnomon."
                     /db_xref="GeneID:106093010"
     CDS             458..>1612
                     /gene="LOC106093010"
                     /note="The sequence of the model RefSeq protein was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: added 438 bases not found in
                     genome assembly"
                     /codon_start=1
                     /product="probable serine/threonine-protein kinase cdc7"
                     /protein_id="XP_013115434.2"
                     /db_xref="GeneID:106093010"
                     /translation="MERRLKNSGNLKGPTATVVPAQLITKVNSPALHQRQPQHNHGTR
                     QRTAAQQKQQQEPAADSIAVASIIPQPQQQPMLTNLSSNNNHVTNDCFNNINNNNNKS
                     VEAAAAALPIVEQQHLAIPTKVISTPRNKNEEAINDLRTRIPEIENIFDIHSRIGNGT
                     FSTVLLGTLKKESNLPENHRRKFAIKHHIPTSHPDRIMKELQCMAKIGGSNNVVGINC
                     CIRYNESVAFIMPYLAHDRFHDFFSKMDVAEVQYYMKNLLIALRHVHRFKIIHRDVKP
                     SNFLYNRRKRQFLLVDFGLAQQVAPSIAANAASSVQSEAKRLREHDDNHVKKSADGSA
                     VAVTGAGEVVSGTAKRIRCTGPDLLMESGTANKSLANAVNTGTLKQSPFKK"
ORIGIN      
        1 gttcacacac aaaataaaaa tttacattca atcatgttcg gttttcgcga gcaaaatcta
       61 atctaattaa tctaaacaaa gcaacaaaga gatatagtga cacaaacaaa acaagagagt
      121 ggagttttac acaactcatt cgagtcactt agcattatag gaaaagtatt tggaatataa
      181 attgaagata tttacaaaaa gaaagcgtac aattttctat agcaaagaat taggaaatta
      241 gaaggaatga aatttgtgca aaatttatgg tgatttcgtt attatttgag cctagtttgt
      301 ttggaaaaaa ttgacggcgt ttttccgcat tgaatggttt ccatttcttt cggaaatttc
      361 agctgttaac cgaaggtaac aaaaaaagaa aaaaataaac gtgttaaaat tgccagcgag
      421 tgaaactaca gaacatattg tctggctaca tcaagtcatg gaaaggaggt tgaaaaattc
      481 cgggaattta aagggtccaa cagcaactgt ggtgccagcg caattgataa ccaaagtcaa
      541 tagcccagct ttgcatcagc ggcagcccca acataatcat ggaactagac aacgtactgc
      601 cgcacaacag aaacaacaac aagaaccggc ggcggacagc atagcagtgg catcaattat
      661 acctcaacca caacaacaac ccatgctaac aaatctcagt agcaataata accacgttac
      721 aaacgactgt tttaataata ttaacaacaa caacaacaaa agtgtggaag cggcagctgc
      781 tgccttgcca attgtggaac aacaacatct ggctattccg actaaggtta tctcaacacc
      841 tcgtaataag aatgaagaag caataaatga cttgcggaca cgcattcctg aaattgaaaa
      901 tatttttgac attcacagtc gcattggaaa tggaacattt agcacagtac ttttgggtac
      961 attgaaaaaa gaatcgaatc tgcctgaaaa ccataggcga aaatttgcta tcaaacacca
     1021 catacctacc agtcatcccg atcgtattat gaaggagttg cagtgcatgg ctaaaattgg
     1081 tggtagcaac aatgtggttg gtatcaattg ctgcattcgc tacaacgaat cggtggcctt
     1141 tattatgccc tatctggccc atgaccgatt tcatgatttc tttagcaaaa tggatgttgc
     1201 cgaagtgcag tattatatga aaaatctatt gatagcattg cgccatgtgc atcgttttaa
     1261 aattatacat cgtgatgtga aacccagcaa ttttctttat aaccgacgta aacgacaatt
     1321 tctattggtc gattttggtt tggcccaaca ggttgccccc agtattgctg ccaatgctgc
     1381 cagcagtgta cagtccgagg caaagagatt acgcgagcac gacgacaatc atgtgaaaaa
     1441 atcagcagat ggttcagctg ttgctgtgac cggtgccgga gaagttgtca gcggcactgc
     1501 aaaacgtata agatgcaccg gacctgattt gctgatggaa tcaggcaccg ccaacaaatc
     1561 tctagcgaat gccgtcaata ctggtacttt aaaacaatcc ccctttaaaa ag