Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013259980 1612 bp mRNA linear INV 02-SEP-2023 kinase cdc7 (LOC106093010), partial mRNA. ACCESSION XM_013259980 VERSION XM_013259980.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; corrected model. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) and transcript sequence (GDIM01037487.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013259980.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## assembly gap :: added 438 transcript bases to patch genome assembly gap ##RefSeq-Attributes-END## COMPLETENESS: incomplete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-857 OY720438.1 3691980-3692836 858-1080 OY720438.1 3693789-3694011 1081-1174 OY720438.1 3698673-3698766 1175-1612 GDIM01037487.1 718-1155 FEATURES Location/Qualifiers source 1..1612 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..>1612 /gene="LOC106093010" /note="probable serine/threonine-protein kinase cdc7; The sequence of the model RefSeq transcript was modified relative to its source genomic sequence to represent the inferred CDS: added 438 bases not found in genome assembly; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106093010" CDS 458..>1612 /gene="LOC106093010" /note="The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: added 438 bases not found in genome assembly" /codon_start=1 /product="probable serine/threonine-protein kinase cdc7" /protein_id="XP_013115434.2" /db_xref="GeneID:106093010" /translation="MERRLKNSGNLKGPTATVVPAQLITKVNSPALHQRQPQHNHGTR QRTAAQQKQQQEPAADSIAVASIIPQPQQQPMLTNLSSNNNHVTNDCFNNINNNNNKS VEAAAAALPIVEQQHLAIPTKVISTPRNKNEEAINDLRTRIPEIENIFDIHSRIGNGT FSTVLLGTLKKESNLPENHRRKFAIKHHIPTSHPDRIMKELQCMAKIGGSNNVVGINC CIRYNESVAFIMPYLAHDRFHDFFSKMDVAEVQYYMKNLLIALRHVHRFKIIHRDVKP SNFLYNRRKRQFLLVDFGLAQQVAPSIAANAASSVQSEAKRLREHDDNHVKKSADGSA VAVTGAGEVVSGTAKRIRCTGPDLLMESGTANKSLANAVNTGTLKQSPFKK" ORIGIN 1 gttcacacac aaaataaaaa tttacattca atcatgttcg gttttcgcga gcaaaatcta 61 atctaattaa tctaaacaaa gcaacaaaga gatatagtga cacaaacaaa acaagagagt 121 ggagttttac acaactcatt cgagtcactt agcattatag gaaaagtatt tggaatataa 181 attgaagata tttacaaaaa gaaagcgtac aattttctat agcaaagaat taggaaatta 241 gaaggaatga aatttgtgca aaatttatgg tgatttcgtt attatttgag cctagtttgt 301 ttggaaaaaa ttgacggcgt ttttccgcat tgaatggttt ccatttcttt cggaaatttc 361 agctgttaac cgaaggtaac aaaaaaagaa aaaaataaac gtgttaaaat tgccagcgag 421 tgaaactaca gaacatattg tctggctaca tcaagtcatg gaaaggaggt tgaaaaattc 481 cgggaattta aagggtccaa cagcaactgt ggtgccagcg caattgataa ccaaagtcaa 541 tagcccagct ttgcatcagc ggcagcccca acataatcat ggaactagac aacgtactgc 601 cgcacaacag aaacaacaac aagaaccggc ggcggacagc atagcagtgg catcaattat 661 acctcaacca caacaacaac ccatgctaac aaatctcagt agcaataata accacgttac 721 aaacgactgt tttaataata ttaacaacaa caacaacaaa agtgtggaag cggcagctgc 781 tgccttgcca attgtggaac aacaacatct ggctattccg actaaggtta tctcaacacc 841 tcgtaataag aatgaagaag caataaatga cttgcggaca cgcattcctg aaattgaaaa 901 tatttttgac attcacagtc gcattggaaa tggaacattt agcacagtac ttttgggtac 961 attgaaaaaa gaatcgaatc tgcctgaaaa ccataggcga aaatttgcta tcaaacacca 1021 catacctacc agtcatcccg atcgtattat gaaggagttg cagtgcatgg ctaaaattgg 1081 tggtagcaac aatgtggttg gtatcaattg ctgcattcgc tacaacgaat cggtggcctt 1141 tattatgccc tatctggccc atgaccgatt tcatgatttc tttagcaaaa tggatgttgc 1201 cgaagtgcag tattatatga aaaatctatt gatagcattg cgccatgtgc atcgttttaa 1261 aattatacat cgtgatgtga aacccagcaa ttttctttat aaccgacgta aacgacaatt 1321 tctattggtc gattttggtt tggcccaaca ggttgccccc agtattgctg ccaatgctgc 1381 cagcagtgta cagtccgagg caaagagatt acgcgagcac gacgacaatc atgtgaaaaa 1441 atcagcagat ggttcagctg ttgctgtgac cggtgccgga gaagttgtca gcggcactgc 1501 aaaacgtata agatgcaccg gacctgattt gctgatggaa tcaggcaccg ccaacaaatc 1561 tctagcgaat gccgtcaata ctggtacttt aaaacaatcc ccctttaaaa ag