Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans zinc finger protein 593 homolog


LOCUS       XM_013259839            1011 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106092887), mRNA.
ACCESSION   XM_013259839
VERSION     XM_013259839.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013259839.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1011
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1011
                     /gene="LOC106092887"
                     /note="zinc finger protein 593 homolog; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 6 Proteins"
                     /db_xref="GeneID:106092887"
     CDS             294..764
                     /gene="LOC106092887"
                     /codon_start=1
                     /product="zinc finger protein 593 homolog"
                     /protein_id="XP_013115293.1"
                     /db_xref="GeneID:106092887"
                     /translation="MGMVQKRKKMHYGDTHLQRRWRVRNRTRDLDQIDQDIQTQSAQL
                     INQPVDLEKPGFAQFYCVHCAKYFIDDVAMQAHFRTKVHKRRLKALEVEPYSIEESER
                     AAGHGNYQKPKKRHMETQPSKDEVKAGKRIRVEVVDEEAATTSKKAAKMQKMET"
     misc_feature    294..608
                     /gene="LOC106092887"
                     /note="U1-like Zn-finger-containing protein [General
                     function prediction only]; Region: UFD2; COG5112"
                     /db_xref="CDD:227443"
     polyA_site      1011
                     /gene="LOC106092887"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ctgactagaa aagaattgac agctgccaca ttaaatgaaa tctgtgcatt aaatagcaaa
       61 caaaaaagat taaacgaaga tattgcgtat ttgttaattt aataagtacc gctttgttga
      121 aggaatagga tctcaataaa tcacttttgg aaaattattg aaacacgaga ggaatcccaa
      181 caaaggcctg ccgcaaacac ctatttttct tgtttacaac aaaaacacgt gttacgctta
      241 tattccatac attttttttt cttcagaaga gagtaccaaa acaaaacttc atcatgggta
      301 tggtacagaa acgtaagaaa atgcactatg gcgatactca tcttcagcga agatggcgtg
      361 tgcgtaatcg cacccgagat ctggaccaaa tcgatcaaga catacaaact cagtcggcac
      421 aattgatcaa tcaacctgta gatttggaaa agccaggttt tgcccaattc tattgcgttc
      481 actgtgccaa gtactttatc gatgatgttg ccatgcaagc acactttcgt actaaggtcc
      541 acaaacgtcg tctaaaggct ttggaagttg agccttactc gatagaagaa tctgaacgtg
      601 ccgctggtca tggtaattat caaaaaccta agaaacgtca tatggaaact cagccatcaa
      661 aagatgaagt caaagctggt aaacgcattc gggtagaagt agtggacgaa gaggcagcaa
      721 ctacatcgaa aaaagcagca aaaatgcaga aaatggaaac atagtatgta aaaagagggc
      781 ttcaaatggt actggcttag tgataatgat atacataatt ttaggataat ttctcccttt
      841 taaaataaaa tgaattttct aaatgtaaaa aaaaaacatt ttttataaat tgtatgtaga
      901 aatcattatt tgagtatttc aaatattgta actaaaagag actcaatgaa aatgtaataa
      961 aaggaagtga tgcctttgtc aatccaaatg tcctttaagg ggctttatgt a