Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans HIG1 domain family member 2A,


LOCUS       XM_013259761             565 bp    mRNA    linear   INV 02-SEP-2023
            mitochondrial (LOC106092833), mRNA.
ACCESSION   XM_013259761
VERSION     XM_013259761.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013259761.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..565
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..565
                     /gene="LOC106092833"
                     /note="HIG1 domain family member 2A, mitochondrial;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 7 Proteins"
                     /db_xref="GeneID:106092833"
     CDS             79..393
                     /gene="LOC106092833"
                     /codon_start=1
                     /product="HIG1 domain family member 2A, mitochondrial"
                     /protein_id="XP_013115215.1"
                     /db_xref="GeneID:106092833"
                     /translation="MSSQAPQKIQLPDEDLDWIQMRMETGPVFPETTKEKMMRKIKEN
                     PLVPIGCVATGCALCYGLYNFRTGNRRMSQMMMRARIAAQGFTVLALIGGVVMTYGKN
                     DK"
     misc_feature    205..360
                     /gene="LOC106092833"
                     /note="Hypoxia induced protein conserved region; Region:
                     HIG_1_N; pfam04588"
                     /db_xref="CDD:461361"
     polyA_site      565
                     /gene="LOC106092833"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cccttttcgt aaacaaactg attttgtttt atatttcgta aagccagttg cagtttttaa
       61 ggaaagataa ttttaaaaat gagttctcaa gcaccacaaa aaatacaatt gcccgatgag
      121 gatttggatt ggatccaaat gcggatggaa acaggcccag tatttccaga aaccacgaaa
      181 gaaaaaatga tgcgtaaaat aaaggaaaac cccctagtgc caattggatg cgtagcaaca
      241 ggatgtgcat tatgttacgg gctgtacaac ttccgtaccg gcaatcgtag aatgtcacag
      301 atgatgatga gggctcgtat tgcagcccaa ggattcaccg tgttagcctt gattggaggg
      361 gtcgttatga cctatgggaa gaacgataag tgaagaaaat cctttatgac atcattctgt
      421 ataaaatgtc gcagttttta aacacttgca atcatttgtg tttgatgttg aattgatgta
      481 catattttta agtagagagc gaatagtagg ttttctataa acttttgtta caattacaac
      541 aaataaataa ggaatgtaac cgcaa