Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013259761 565 bp mRNA linear INV 02-SEP-2023 mitochondrial (LOC106092833), mRNA. ACCESSION XM_013259761 VERSION XM_013259761.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013259761.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..565 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..565 /gene="LOC106092833" /note="HIG1 domain family member 2A, mitochondrial; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:106092833" CDS 79..393 /gene="LOC106092833" /codon_start=1 /product="HIG1 domain family member 2A, mitochondrial" /protein_id="XP_013115215.1" /db_xref="GeneID:106092833" /translation="MSSQAPQKIQLPDEDLDWIQMRMETGPVFPETTKEKMMRKIKEN PLVPIGCVATGCALCYGLYNFRTGNRRMSQMMMRARIAAQGFTVLALIGGVVMTYGKN DK" misc_feature 205..360 /gene="LOC106092833" /note="Hypoxia induced protein conserved region; Region: HIG_1_N; pfam04588" /db_xref="CDD:461361" polyA_site 565 /gene="LOC106092833" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cccttttcgt aaacaaactg attttgtttt atatttcgta aagccagttg cagtttttaa 61 ggaaagataa ttttaaaaat gagttctcaa gcaccacaaa aaatacaatt gcccgatgag 121 gatttggatt ggatccaaat gcggatggaa acaggcccag tatttccaga aaccacgaaa 181 gaaaaaatga tgcgtaaaat aaaggaaaac cccctagtgc caattggatg cgtagcaaca 241 ggatgtgcat tatgttacgg gctgtacaac ttccgtaccg gcaatcgtag aatgtcacag 301 atgatgatga gggctcgtat tgcagcccaa ggattcaccg tgttagcctt gattggaggg 361 gtcgttatga cctatgggaa gaacgataag tgaagaaaat cctttatgac atcattctgt 421 ataaaatgtc gcagttttta aacacttgca atcatttgtg tttgatgttg aattgatgta 481 catattttta agtagagagc gaatagtagg ttttctataa acttttgtta caattacaac 541 aaataaataa ggaatgtaac cgcaa