Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013259648 873 bp mRNA linear INV 02-SEP-2023 (LOC106092732), mRNA. ACCESSION XM_013259648 VERSION XM_013259648.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013259648.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..873 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..873 /gene="LOC106092732" /note="farnesol dehydrogenase; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 EST, 9 Proteins" /db_xref="GeneID:106092732" CDS 20..766 /gene="LOC106092732" /codon_start=1 /product="farnesol dehydrogenase" /protein_id="XP_013115102.2" /db_xref="GeneID:106092732" /translation="MERWHDKVAVVTGASSGIGAAIALELVQQGLQVIGLARRLDKLE AIRNQLPEEKQSRFTPLTCYVCDAECVNATYKTIIEKFGGVDVLINCAGTTAWGQLLT MEVQELQQILQTNVMGIVHCTQKAFQSMRERNVAGHVFVINSVLGHKVFHNKPLPDLN MYCPSKYAVTAMTEILRQEFRGLDTKIKITSISPGLVATEMIPEQLKTAVGDCILEPK DVAAAIMYALSTPPHVQVHEIILKPLGEAV" ORIGIN 1 gcaccaacgc tgagtgacaa tggagcgttg gcatgataag gtggcagtag ttacgggagc 61 cagctcgggt attggtgcag ccattgcctt agaattggta caacaagggc tacaggtgat 121 tggcttggct agaagacttg acaaattgga agcaattcga aatcagctgc ctgaggaaaa 181 acaaagtcgt ttcactcctc taacttgcta cgtctgtgat gcagaatgtg taaatgccac 241 atacaagaca atcatagaaa aatttggtgg cgtggatgtt ttgataaatt gtgccggtac 301 cacagcatgg ggccaattgc tcaccatgga ggtccaggaa ctgcaacaga tattacaaac 361 aaatgttatg ggcattgttc attgcaccca aaaggctttt caatcgatga gagagcgcaa 421 tgtcgcaggt cacgtttttg tgatcaacag tgtgttgggt cataaggttt tccataataa 481 accattgccc gatttgaata tgtattgtcc ttcgaaatat gctgttacag ccatgacgga 541 aattctaagg caggaattca gaggattgga taccaaaatt aaaattacaa gtatcagtcc 601 tggtttggtg gctaccgaaa tgatacccga acagttgaaa actgcagtgg gtgactgcat 661 tctggaacct aaagatgttg cagctgccat aatgtatgcc ctttcaacac cgccgcatgt 721 gcaagtccat gaaattattt taaagccgct gggtgaagct gtttaaaaaa gggaaaaatt 781 gtgtggaata ttaacaaccg atcatatttt agtgaaatct aaaatttctt cctcagacta 841 aaacttaaat gaaattttta acaaaaattt ctt