Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans farnesol dehydrogenase


LOCUS       XM_013259648             873 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106092732), mRNA.
ACCESSION   XM_013259648
VERSION     XM_013259648.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013259648.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..873
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..873
                     /gene="LOC106092732"
                     /note="farnesol dehydrogenase; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1 EST,
                     9 Proteins"
                     /db_xref="GeneID:106092732"
     CDS             20..766
                     /gene="LOC106092732"
                     /codon_start=1
                     /product="farnesol dehydrogenase"
                     /protein_id="XP_013115102.2"
                     /db_xref="GeneID:106092732"
                     /translation="MERWHDKVAVVTGASSGIGAAIALELVQQGLQVIGLARRLDKLE
                     AIRNQLPEEKQSRFTPLTCYVCDAECVNATYKTIIEKFGGVDVLINCAGTTAWGQLLT
                     MEVQELQQILQTNVMGIVHCTQKAFQSMRERNVAGHVFVINSVLGHKVFHNKPLPDLN
                     MYCPSKYAVTAMTEILRQEFRGLDTKIKITSISPGLVATEMIPEQLKTAVGDCILEPK
                     DVAAAIMYALSTPPHVQVHEIILKPLGEAV"
ORIGIN      
        1 gcaccaacgc tgagtgacaa tggagcgttg gcatgataag gtggcagtag ttacgggagc
       61 cagctcgggt attggtgcag ccattgcctt agaattggta caacaagggc tacaggtgat
      121 tggcttggct agaagacttg acaaattgga agcaattcga aatcagctgc ctgaggaaaa
      181 acaaagtcgt ttcactcctc taacttgcta cgtctgtgat gcagaatgtg taaatgccac
      241 atacaagaca atcatagaaa aatttggtgg cgtggatgtt ttgataaatt gtgccggtac
      301 cacagcatgg ggccaattgc tcaccatgga ggtccaggaa ctgcaacaga tattacaaac
      361 aaatgttatg ggcattgttc attgcaccca aaaggctttt caatcgatga gagagcgcaa
      421 tgtcgcaggt cacgtttttg tgatcaacag tgtgttgggt cataaggttt tccataataa
      481 accattgccc gatttgaata tgtattgtcc ttcgaaatat gctgttacag ccatgacgga
      541 aattctaagg caggaattca gaggattgga taccaaaatt aaaattacaa gtatcagtcc
      601 tggtttggtg gctaccgaaa tgatacccga acagttgaaa actgcagtgg gtgactgcat
      661 tctggaacct aaagatgttg cagctgccat aatgtatgcc ctttcaacac cgccgcatgt
      721 gcaagtccat gaaattattt taaagccgct gggtgaagct gtttaaaaaa gggaaaaatt
      781 gtgtggaata ttaacaaccg atcatatttt agtgaaatct aaaatttctt cctcagacta
      841 aaacttaaat gaaattttta acaaaaattt ctt