Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106092718


LOCUS       XM_013259636             825 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106092718), mRNA.
ACCESSION   XM_013259636
VERSION     XM_013259636.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013259636.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..825
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..825
                     /gene="LOC106092718"
                     /note="uncharacterized LOC106092718; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:106092718"
     CDS             135..818
                     /gene="LOC106092718"
                     /codon_start=1
                     /product="uncharacterized protein LOC106092718"
                     /protein_id="XP_013115090.1"
                     /db_xref="GeneID:106092718"
                     /translation="MSSDSEYEEHMKKMLEASDTTFLNNEMFKDKSKINAKEIDKHTS
                     VKNPDLLKSQRYLLDDDDDNGQDFNLPETMQKHMAKKLSEILENTYEFGDFASESECT
                     KTKSKSRVKLLKGDVNYVKSYEEFEYETKGPDKKPEIKRRCVDKTESSVLNDNHQLKK
                     IAIDGNDILAGNEVKFWAVKKERKDRIFHYREGANGVAHAKETINEFTALRRKNNWNE
                     SKIKDYRRT"
     polyA_site      825
                     /gene="LOC106092718"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tcgatttacg atccagactc tttggttggg tttagagtcg taacttgcac gtgtgtattt
       61 gtttgtaaac aatatttttt ttaatataca aaacttagac gatagggagt taagtttcaa
      121 aatcatttgt aaaaatgtcc agtgattcag aatacgaaga acatatgaaa aaaatgttgg
      181 aagcttcaga cacgactttt ttgaacaatg aaatgtttaa ggacaaaagc aaaataaatg
      241 ccaaggaaat cgataagcat accagcgtta aaaacccaga ccttttaaaa tcacaacgtt
      301 atcttttgga cgacgatgat gataacggac aagattttaa cctccctgaa acaatgcaaa
      361 aacatatggc taaaaagttg tcagaaattt tagaaaatac ctacgagttt ggtgattttg
      421 ctagtgagtc ggaatgtaca aaaactaaga gtaaaagccg tgtcaagtta ttaaaaggcg
      481 atgtgaatta cgtaaagtct tatgaagaat tcgaatacga aacgaaaggt cccgacaaaa
      541 agcctgaaat caagagacga tgtgttgata aaaccgaatc gtctgttcta aatgataatc
      601 atcaactaaa gaaaattgcc attgatggca atgatatatt agctgggaat gaagtcaagt
      661 tttgggctgt taaaaaagaa agaaaagaca gaatatttca ctatagggaa ggagcaaatg
      721 gagtagccca tgctaaagaa actataaacg agtttacagc tctaaggcgt aaaaacaatt
      781 ggaacgaaag caaaataaaa gattatagaa gaacataaaa aataa