Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans gametocyte-specific factor 1 homolog


LOCUS       XM_013259623             687 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106092712), mRNA.
ACCESSION   XM_013259623
VERSION     XM_013259623.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013259623.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..687
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..687
                     /gene="LOC106092712"
                     /note="gametocyte-specific factor 1 homolog; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 3 Proteins"
                     /db_xref="GeneID:106092712"
     CDS             120..560
                     /gene="LOC106092712"
                     /codon_start=1
                     /product="gametocyte-specific factor 1 homolog"
                     /protein_id="XP_013115077.2"
                     /db_xref="GeneID:106092712"
                     /translation="MENAETQDMIECPYDKHHQILRTRMQVHLSRCRRNHTNLKKTTC
                     PFNVTHVLNEPELEFHVSVCTERKSLEHFRNVVNAPTKPTIPPPMPVYESEETWDDDE
                     TPSYNPQHYAANSNVLRSIQGASPAQRKAFRKQERLRLLGIDNN"
ORIGIN      
        1 gacagcattc tgcttgaaaa gctgaacaga atactcagct taatctgaca acactgagca
       61 acaaaaacat taaccttatc aaccaagcca aaatcagaat aattattttt ttgagaacga
      121 tggagaacgc agaaactcag gatatgatag aatgtccata tgataaacat caccagatat
      181 tgaggacgcg gatgcaggtg catttatcac gctgcaggcg aaatcacacc aatttgaaaa
      241 aaactacatg tccgtttaac gtgacacacg tactaaatga accagaactt gagtttcacg
      301 ttagtgtttg tactgaacgg aaatcgcttg aacattttag aaatgtagta aatgccccaa
      361 caaaaccaac tatacctcct cctatgcctg tttatgaaag tgaagaaact tgggacgatg
      421 acgaaacacc atcttataat ccccaacatt atgccgctaa ctccaacgtc ttacgttcca
      481 tacaaggagc ttcaccagca cagagaaaag catttcgcaa acaagaacga ttgcgactgc
      541 ttggcattga taacaattag catcatttta taactgtttt aattttggat gtgatttgta
      601 tatgtttgtc gattttaaat gcagaatata tgtttacctt tatttttata taaattttcc
      661 tatatttcaa ttattataca tatagtt