Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013259623 687 bp mRNA linear INV 02-SEP-2023 (LOC106092712), mRNA. ACCESSION XM_013259623 VERSION XM_013259623.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013259623.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..687 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..687 /gene="LOC106092712" /note="gametocyte-specific factor 1 homolog; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:106092712" CDS 120..560 /gene="LOC106092712" /codon_start=1 /product="gametocyte-specific factor 1 homolog" /protein_id="XP_013115077.2" /db_xref="GeneID:106092712" /translation="MENAETQDMIECPYDKHHQILRTRMQVHLSRCRRNHTNLKKTTC PFNVTHVLNEPELEFHVSVCTERKSLEHFRNVVNAPTKPTIPPPMPVYESEETWDDDE TPSYNPQHYAANSNVLRSIQGASPAQRKAFRKQERLRLLGIDNN" ORIGIN 1 gacagcattc tgcttgaaaa gctgaacaga atactcagct taatctgaca acactgagca 61 acaaaaacat taaccttatc aaccaagcca aaatcagaat aattattttt ttgagaacga 121 tggagaacgc agaaactcag gatatgatag aatgtccata tgataaacat caccagatat 181 tgaggacgcg gatgcaggtg catttatcac gctgcaggcg aaatcacacc aatttgaaaa 241 aaactacatg tccgtttaac gtgacacacg tactaaatga accagaactt gagtttcacg 301 ttagtgtttg tactgaacgg aaatcgcttg aacattttag aaatgtagta aatgccccaa 361 caaaaccaac tatacctcct cctatgcctg tttatgaaag tgaagaaact tgggacgatg 421 acgaaacacc atcttataat ccccaacatt atgccgctaa ctccaacgtc ttacgttcca 481 tacaaggagc ttcaccagca cagagaaaag catttcgcaa acaagaacga ttgcgactgc 541 ttggcattga taacaattag catcatttta taactgtttt aattttggat gtgatttgta 601 tatgtttgtc gattttaaat gcagaatata tgtttacctt tatttttata taaattttcc 661 tatatttcaa ttattataca tatagtt