Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013259614 994 bp mRNA linear INV 02-SEP-2023 (LOC106092703), mRNA. ACCESSION XM_013259614 VERSION XM_013259614.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013259614.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..994 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..994 /gene="LOC106092703" /note="farnesol dehydrogenase; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 22 Proteins" /db_xref="GeneID:106092703" CDS 198..944 /gene="LOC106092703" /codon_start=1 /product="farnesol dehydrogenase" /protein_id="XP_013115068.2" /db_xref="GeneID:106092703" /translation="MERWQNRVACVTGASSGIGAAIAKDLVNAGLIVVGLARRTERME EICGSLPQNLQSRLHGVKCDVTSEQSVNEAFDWIEQHLGGVDVLINNAGTHVSGQLLT METSALQQTMQTNVMGMVYCTRRAFVSMQKRNIGDGHVVLINSILGHTIFQRSPGLVS HLNMYPVTKYGVTALAEILRQEFWDLETKIKITSLSPGVVDTDIVPDNFRHLPKLKAE DISAGVMYILATPPHVQVHELIIKPLGEPF" polyA_site 994 /gene="LOC106092703" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cagaaaaact gcttcagtag cacaatagat tacaaagtgt aatagtcaat tgttaacgtg 61 gcagttttcg attttgatat aacaaacggt ggcaatagag gcgaaaacta ccattgccct 121 gcgttgccaa tcatacaaac aaacaatcga cgcataataa accacatccc aacgtgttgt 181 tgacgcactg caaacaaatg gaacggtggc aaaatcgtgt ggcatgtgtt accggtgcca 241 gttcgggtat tggggctgcc attgccaaag acttggttaa tgccggcctc attgtggtag 301 gtttggcacg acgcaccgag cgtatggaag agatatgcgg cagtttaccc caaaacttgc 361 agtcacgttt acatggcgtc aaatgtgatg ttaccagtga gcaatctgtc aatgaggcat 421 tcgattggat cgaacagcat ttgggtggtg ttgatgtctt gataaacaat gccggcaccc 481 atgtgtccgg tcaactattg accatggaga cgagtgcact tcaacaaact atgcaaacca 541 atgtcatggg tatggtttac tgtacacgtc gggcattcgt atctatgcag aaacgtaaca 601 ttggggatgg tcatgtggta ttgattaata gcattttggg acatacgatt ttccaacgct 661 caccggggtt ggtgtcccac ttgaatatgt atcctgtaac gaaatatggc gtaacagctt 721 tggcggaaat tttgcggcaa gaattttggg atctggaaac aaaaattaaa ataacgagtc 781 ttagtcctgg cgtggtggac acagatatag ttccggataa tttcaggcat ttgccaaagc 841 taaaggccga agatatctca gctggcgtaa tgtacatttt ggccacacct ccccatgtac 901 aagtgcacga gttgatcata aagccacttg gagaaccctt ttaagtgtaa tgacataatt 961 gtcaagttcc aaataaatca ctaaaaattt ttta