Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans farnesol dehydrogenase


LOCUS       XM_013259614             994 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106092703), mRNA.
ACCESSION   XM_013259614
VERSION     XM_013259614.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013259614.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..994
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..994
                     /gene="LOC106092703"
                     /note="farnesol dehydrogenase; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 22
                     Proteins"
                     /db_xref="GeneID:106092703"
     CDS             198..944
                     /gene="LOC106092703"
                     /codon_start=1
                     /product="farnesol dehydrogenase"
                     /protein_id="XP_013115068.2"
                     /db_xref="GeneID:106092703"
                     /translation="MERWQNRVACVTGASSGIGAAIAKDLVNAGLIVVGLARRTERME
                     EICGSLPQNLQSRLHGVKCDVTSEQSVNEAFDWIEQHLGGVDVLINNAGTHVSGQLLT
                     METSALQQTMQTNVMGMVYCTRRAFVSMQKRNIGDGHVVLINSILGHTIFQRSPGLVS
                     HLNMYPVTKYGVTALAEILRQEFWDLETKIKITSLSPGVVDTDIVPDNFRHLPKLKAE
                     DISAGVMYILATPPHVQVHELIIKPLGEPF"
     polyA_site      994
                     /gene="LOC106092703"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cagaaaaact gcttcagtag cacaatagat tacaaagtgt aatagtcaat tgttaacgtg
       61 gcagttttcg attttgatat aacaaacggt ggcaatagag gcgaaaacta ccattgccct
      121 gcgttgccaa tcatacaaac aaacaatcga cgcataataa accacatccc aacgtgttgt
      181 tgacgcactg caaacaaatg gaacggtggc aaaatcgtgt ggcatgtgtt accggtgcca
      241 gttcgggtat tggggctgcc attgccaaag acttggttaa tgccggcctc attgtggtag
      301 gtttggcacg acgcaccgag cgtatggaag agatatgcgg cagtttaccc caaaacttgc
      361 agtcacgttt acatggcgtc aaatgtgatg ttaccagtga gcaatctgtc aatgaggcat
      421 tcgattggat cgaacagcat ttgggtggtg ttgatgtctt gataaacaat gccggcaccc
      481 atgtgtccgg tcaactattg accatggaga cgagtgcact tcaacaaact atgcaaacca
      541 atgtcatggg tatggtttac tgtacacgtc gggcattcgt atctatgcag aaacgtaaca
      601 ttggggatgg tcatgtggta ttgattaata gcattttggg acatacgatt ttccaacgct
      661 caccggggtt ggtgtcccac ttgaatatgt atcctgtaac gaaatatggc gtaacagctt
      721 tggcggaaat tttgcggcaa gaattttggg atctggaaac aaaaattaaa ataacgagtc
      781 ttagtcctgg cgtggtggac acagatatag ttccggataa tttcaggcat ttgccaaagc
      841 taaaggccga agatatctca gctggcgtaa tgtacatttt ggccacacct ccccatgtac
      901 aagtgcacga gttgatcata aagccacttg gagaaccctt ttaagtgtaa tgacataatt
      961 gtcaagttcc aaataaatca ctaaaaattt ttta