PREDICTED: Stomoxys calcitrans uncharacterized LOC106092682

LOCUS       XM_013259596             648 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106092682), mRNA.
ACCESSION   XM_013259596
VERSION     XM_013259596.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013259596.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 53% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..648
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..648
                     /gene="LOC106092682"
                     /note="uncharacterized LOC106092682; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:106092682"
     CDS             1..648
                     /gene="LOC106092682"
                     /codon_start=1
                     /product="uncharacterized protein LOC106092682"
                     /protein_id="XP_013115050.2"
                     /db_xref="GeneID:106092682"
                     /translation="MANIFVANCKLPLIYPKKVGSAFKLIFGFGVPWDGLLVETITSG
                     MVWRVHFRLPGSLQQLKHRHYTTLGRRLDNWSEDYAEHHFPGNSTWALKNGLELEKYV
                     HTSYRWGFYQTMEGLATRIGLNGRLCVLKSICEAAKDPFHIDNGLWAELLNILLMPSS
                     SVDKLSQHSDNDYYQAEYMGRSGANCNKVFASCPRSLLDHFSNFYKLTDELRQAF"
ORIGIN      
        1 atggcaaata ttttcgtcgc aaattgcaag ttgcccctga tatatcccaa aaaagtgggc
       61 agcgctttta agctgatttt tggctttggt gtaccctggg atggtttgct agtggaaact
      121 attacttcag gtatggtatg gcgagtgcat tttcgtctac caggatcctt gcagcaattg
      181 aagcataggc attatacaac tcttggacgt agattggata attggtcaga agattatgct
      241 gagcatcatt tcccaggtaa ttccacctgg gcacttaaaa atggtctgga attggaaaaa
      301 tatgttcata ccagttatcg ttggggattt tatcaaacta tggagggttt ggccacaaga
      361 ataggcttaa atggccgttt gtgtgttttg aagagtattt gcgaggcagc caaagatccc
      421 tttcacattg ataatggctt atgggctgaa ctgttgaata ttttactaat gccctcctct
      481 tcggtggaca agttgtctca gcacagtgac aatgactatt accaggctga atatatgggt
      541 cgttcaggtg ccaattgcaa taaggtcttt gcaagttgtc cacgttcttt actggatcat
      601 ttcagcaatt tttataaact cacagatgag ctaaggcagg ctttttaa