Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013259596 648 bp mRNA linear INV 02-SEP-2023 (LOC106092682), mRNA. ACCESSION XM_013259596 VERSION XM_013259596.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013259596.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 53% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..648 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..648 /gene="LOC106092682" /note="uncharacterized LOC106092682; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106092682" CDS 1..648 /gene="LOC106092682" /codon_start=1 /product="uncharacterized protein LOC106092682" /protein_id="XP_013115050.2" /db_xref="GeneID:106092682" /translation="MANIFVANCKLPLIYPKKVGSAFKLIFGFGVPWDGLLVETITSG MVWRVHFRLPGSLQQLKHRHYTTLGRRLDNWSEDYAEHHFPGNSTWALKNGLELEKYV HTSYRWGFYQTMEGLATRIGLNGRLCVLKSICEAAKDPFHIDNGLWAELLNILLMPSS SVDKLSQHSDNDYYQAEYMGRSGANCNKVFASCPRSLLDHFSNFYKLTDELRQAF" ORIGIN 1 atggcaaata ttttcgtcgc aaattgcaag ttgcccctga tatatcccaa aaaagtgggc 61 agcgctttta agctgatttt tggctttggt gtaccctggg atggtttgct agtggaaact 121 attacttcag gtatggtatg gcgagtgcat tttcgtctac caggatcctt gcagcaattg 181 aagcataggc attatacaac tcttggacgt agattggata attggtcaga agattatgct 241 gagcatcatt tcccaggtaa ttccacctgg gcacttaaaa atggtctgga attggaaaaa 301 tatgttcata ccagttatcg ttggggattt tatcaaacta tggagggttt ggccacaaga 361 ataggcttaa atggccgttt gtgtgttttg aagagtattt gcgaggcagc caaagatccc 421 tttcacattg ataatggctt atgggctgaa ctgttgaata ttttactaat gccctcctct 481 tcggtggaca agttgtctca gcacagtgac aatgactatt accaggctga atatatgggt 541 cgttcaggtg ccaattgcaa taaggtcttt gcaagttgtc cacgttcttt actggatcat 601 ttcagcaatt tttataaact cacagatgag ctaaggcagg ctttttaa