Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans keratin-associated protein 21-1-like


LOCUS       XM_013259549             772 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106092637), mRNA.
ACCESSION   XM_013259549
VERSION     XM_013259549.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013259549.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..772
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..772
                     /gene="LOC106092637"
                     /note="keratin-associated protein 21-1-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:106092637"
     CDS             110..664
                     /gene="LOC106092637"
                     /codon_start=1
                     /product="keratin-associated protein 21-1-like"
                     /protein_id="XP_013115003.2"
                     /db_xref="GeneID:106092637"
                     /translation="MKAYVCVIALIALLAPTQATFDKLGLLAGGSLGYGNGYNGGYGG
                     GYGSGYGGGYGGGYGGGYGSGYGGGYGGGYGGGYGGGYGSNVKVIKVTVVPSGGGYGG
                     GYGGGYGGGYGGSYGGGYGGGYGVTPIATVATPVITAVSTPVVSGYGGSYGAGSYGYG
                     YGSNVIPSYGGGVGLGYGAAADCF"
     polyA_site      772
                     /gene="LOC106092637"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tccattagga aagcattctt acaaaataat ttcggaagta ttcttaggcg ctttcaaaaa
       61 tattaatctg aagttttaac aaaatcgccg aacttttgaa acaattacaa tgaaagccta
      121 cgtgtgtgtg attgcattga ttgccctgct ggctcccact caagccacat ttgacaagct
      181 gggtttattg gctggaggct cactgggtta tgggaatggc tataatggtg gctatggcgg
      241 aggatatggc agtggttatg gtggaggata tggtggcggg tatggaggag gatacggtag
      301 cggctatgga ggaggatacg gtggcggtta tggaggaggt tatggcggcg gatatggcag
      361 taacgtgaaa gttatcaaag tcactgtggt tcccagcggt ggcggctatg gcggtggcta
      421 tggtggaggt tatggcggtg gctatggcgg tagctacggt ggtggctacg gtggtggcta
      481 cggtgtaacc cccattgcca ctgttgctac tccagtcata actgccgtct caacacctgt
      541 tgtttctgga tatggaggct cctatggcgc aggctcttac ggatacggtt atggcagcaa
      601 tgttattcct tcttatggag gtggtgtagg tttaggttac ggagcagctg ctgactgctt
      661 ctaatactgg aacaagtacc atgttactcc ttgttttgca acacattcta atgaaaggtt
      721 tgctaattgt taacagtatt atttaaataa aattgtttta ctcgaaactt ta