Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013259549 772 bp mRNA linear INV 02-SEP-2023 (LOC106092637), mRNA. ACCESSION XM_013259549 VERSION XM_013259549.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013259549.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..772 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..772 /gene="LOC106092637" /note="keratin-associated protein 21-1-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106092637" CDS 110..664 /gene="LOC106092637" /codon_start=1 /product="keratin-associated protein 21-1-like" /protein_id="XP_013115003.2" /db_xref="GeneID:106092637" /translation="MKAYVCVIALIALLAPTQATFDKLGLLAGGSLGYGNGYNGGYGG GYGSGYGGGYGGGYGGGYGSGYGGGYGGGYGGGYGGGYGSNVKVIKVTVVPSGGGYGG GYGGGYGGGYGGSYGGGYGGGYGVTPIATVATPVITAVSTPVVSGYGGSYGAGSYGYG YGSNVIPSYGGGVGLGYGAAADCF" polyA_site 772 /gene="LOC106092637" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tccattagga aagcattctt acaaaataat ttcggaagta ttcttaggcg ctttcaaaaa 61 tattaatctg aagttttaac aaaatcgccg aacttttgaa acaattacaa tgaaagccta 121 cgtgtgtgtg attgcattga ttgccctgct ggctcccact caagccacat ttgacaagct 181 gggtttattg gctggaggct cactgggtta tgggaatggc tataatggtg gctatggcgg 241 aggatatggc agtggttatg gtggaggata tggtggcggg tatggaggag gatacggtag 301 cggctatgga ggaggatacg gtggcggtta tggaggaggt tatggcggcg gatatggcag 361 taacgtgaaa gttatcaaag tcactgtggt tcccagcggt ggcggctatg gcggtggcta 421 tggtggaggt tatggcggtg gctatggcgg tagctacggt ggtggctacg gtggtggcta 481 cggtgtaacc cccattgcca ctgttgctac tccagtcata actgccgtct caacacctgt 541 tgtttctgga tatggaggct cctatggcgc aggctcttac ggatacggtt atggcagcaa 601 tgttattcct tcttatggag gtggtgtagg tttaggttac ggagcagctg ctgactgctt 661 ctaatactgg aacaagtacc atgttactcc ttgttttgca acacattcta atgaaaggtt 721 tgctaattgt taacagtatt atttaaataa aattgtttta ctcgaaactt ta