Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013259545 603 bp mRNA linear INV 02-SEP-2023 (LOC106092633), mRNA. ACCESSION XM_013259545 VERSION XM_013259545.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013259545.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..603 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..603 /gene="LOC106092633" /note="keratin, type I cytoskeletal 9-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:106092633" CDS 1..603 /gene="LOC106092633" /codon_start=1 /product="keratin, type I cytoskeletal 9-like" /protein_id="XP_013114999.2" /db_xref="GeneID:106092633" /translation="MKAFLFAIGLVALLNSTQATFEKLGLVVGGGVGAVGYNNNYGSG YSGYRSSRSYSGSYGYGGGNGAGYGGSYSPGYTNNVKVIKVTVAPSTGSYGSYGGGSY GAGYGGSYSVAPVAAITTPLITAVTTPVVTSGINSYGSSGYGGYGAGSYFGGAYESGH YGGGYGASIPATFGYGPGYGYGGGFGLGFGPTVGSFPNCF" ORIGIN 1 atgaaggcct tcctgtttgc cattggtttg gtggctctgc ttaattcaac tcaggcaact 61 tttgaaaagt tgggtctagt tgtcggtggt ggcgtaggag cagttggcta taataacaac 121 tatggttctg gttatagcgg ttaccgaagc agcaggtcat atagtggtag ttacggttat 181 gggggtggca acggtgcagg ttatggaggc agttatagcc ctggatatac aaataatgtc 241 aaagtgataa aagttactgt ggcacctagc actggctcat acgggagcta tggcggtgga 301 tcctatggtg caggatatgg cggcagctat agcgttgctc ctgtggccgc tattacaaca 361 ccattaataa ctgcagtcac tacacccgtt gttacatcgg gcattaattc ttatggcagc 421 agtggttatg gtggctatgg ggctggctct tactttggtg gagcatatga aagtggccac 481 tatggcggtg gatatggagc cagtattcca gccacatttg gttatggtcc aggttatggc 541 tatggaggcg gctttggttt gggttttgga cccactgtag gaagttttcc caactgcttt 601 taa