PREDICTED: Stomoxys calcitrans keratin, type I cytoskeletal 9-like

LOCUS       XM_013259545             603 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106092633), mRNA.
ACCESSION   XM_013259545
VERSION     XM_013259545.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013259545.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..603
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..603
                     /gene="LOC106092633"
                     /note="keratin, type I cytoskeletal 9-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 3 Proteins"
                     /db_xref="GeneID:106092633"
     CDS             1..603
                     /gene="LOC106092633"
                     /codon_start=1
                     /product="keratin, type I cytoskeletal 9-like"
                     /protein_id="XP_013114999.2"
                     /db_xref="GeneID:106092633"
                     /translation="MKAFLFAIGLVALLNSTQATFEKLGLVVGGGVGAVGYNNNYGSG
                     YSGYRSSRSYSGSYGYGGGNGAGYGGSYSPGYTNNVKVIKVTVAPSTGSYGSYGGGSY
                     GAGYGGSYSVAPVAAITTPLITAVTTPVVTSGINSYGSSGYGGYGAGSYFGGAYESGH
                     YGGGYGASIPATFGYGPGYGYGGGFGLGFGPTVGSFPNCF"
ORIGIN      
        1 atgaaggcct tcctgtttgc cattggtttg gtggctctgc ttaattcaac tcaggcaact
       61 tttgaaaagt tgggtctagt tgtcggtggt ggcgtaggag cagttggcta taataacaac
      121 tatggttctg gttatagcgg ttaccgaagc agcaggtcat atagtggtag ttacggttat
      181 gggggtggca acggtgcagg ttatggaggc agttatagcc ctggatatac aaataatgtc
      241 aaagtgataa aagttactgt ggcacctagc actggctcat acgggagcta tggcggtgga
      301 tcctatggtg caggatatgg cggcagctat agcgttgctc ctgtggccgc tattacaaca
      361 ccattaataa ctgcagtcac tacacccgtt gttacatcgg gcattaattc ttatggcagc
      421 agtggttatg gtggctatgg ggctggctct tactttggtg gagcatatga aagtggccac
      481 tatggcggtg gatatggagc cagtattcca gccacatttg gttatggtcc aggttatggc
      541 tatggaggcg gctttggttt gggttttgga cccactgtag gaagttttcc caactgcttt
      601 taa