Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans small ubiquitin-related modifier 2


LOCUS       XM_013259492             912 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106092600), mRNA.
ACCESSION   XM_013259492
VERSION     XM_013259492.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013259492.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..912
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..912
                     /gene="LOC106092600"
                     /note="small ubiquitin-related modifier 2; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 16 Proteins"
                     /db_xref="GeneID:106092600"
     CDS             199..474
                     /gene="LOC106092600"
                     /codon_start=1
                     /product="small ubiquitin-related modifier 2"
                     /protein_id="XP_013114946.1"
                     /db_xref="GeneID:106092600"
                     /translation="MADEKKGSETEHINLKVLGQDNAVVQFKIKKHTPLRKLMNAYCD
                     RAGLSMQVVRFRFDGQPINENDTPTSLEMEEGDTIEVYQQQTGGNIY"
     misc_feature    232..447
                     /gene="LOC106092600"
                     /note="ubiquitin-like (Ubl) domain found in small
                     ubiquitin-related modifier SUMO-2, SUMO-3, SUMO-4, and
                     similar proteins; Region: Ubl_SUMO2_3_4; cd16115"
                     /db_xref="CDD:340532"
     misc_feature    order(232..234,238..240,265..300,304..309,319..324,
                     328..336,349..351,385..393,397..399)
                     /gene="LOC106092600"
                     /note="SUMO2 dimer-RNF4 SIM2-3 interaction site
                     [polypeptide binding]; other site"
                     /db_xref="CDD:340532"
     misc_feature    order(232..234,259..288,307..309,328..336)
                     /gene="LOC106092600"
                     /note="SUMO2-TDG interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:340532"
     misc_feature    order(232..234,271..288,292..300,307..312,319..324,
                     331..333)
                     /gene="LOC106092600"
                     /note="SUMO3-MCAF1 interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:340532"
     misc_feature    order(238..240,250..288,295..297,307..312,319..321,
                     331..336,340..345,349..357,364..366,370..372,376..378,
                     442..447)
                     /gene="LOC106092600"
                     /note="SUMO2-Rangap1-UBC9-ZNF451 complex [polypeptide
                     binding]; other site"
                     /db_xref="CDD:340532"
     misc_feature    order(256..282,286..288,307..309,331..333,358..360,
                     445..447)
                     /gene="LOC106092600"
                     /note="SUMO2-Rangap1-UBC9-RanBP2 complex [polypeptide
                     binding]; other site"
                     /db_xref="CDD:340532"
     misc_feature    order(256..258,349..351,358..360,364..366,370..381,
                     385..387,394..396,427..429,436..438,442..447)
                     /gene="LOC106092600"
                     /note="SUMO2-SENP1 interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:340532"
     misc_feature    order(349..351,358..360,364..375,379..381,385..387,
                     394..396,409..411,427..429,436..438,442..447)
                     /gene="LOC106092600"
                     /note="SUMO2-SENP2 [polypeptide binding]; other site"
                     /db_xref="CDD:340532"
     misc_feature    order(349..351,358..360,364..366,370..375,379..381,
                     385..387,394..396,427..429,436..438,442..447)
                     /gene="LOC106092600"
                     /note="SUMO2-SENP2-Rangap1 complex [polypeptide binding];
                     other site"
                     /db_xref="CDD:340532"
     polyA_site      912
                     /gene="LOC106092600"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aagatggctg atgcgtcgcg gcggcttttt tcttgataca ttttcttcgg ttctgcttaa
       61 cgaaaatttt cgcaaggcag cagcagtatt tgattgtccc gcaagtgtgt tgaacgatag
      121 gctggagtga caggaattgt tgtgctatta aattattttt acattgtaaa cctttaaaaa
      181 accaacacaa gttaaaaaat ggctgatgaa aagaagggat ccgaaaccga acacatcaat
      241 cttaaagttt tgggacaaga caatgctgtg gtgcagttca aaattaagaa acatactccc
      301 ctcagaaagc ttatgaatgc ctactgcgac agagcgggtt tgtccatgca agtggtacgg
      361 tttcgctttg atggccaacc tataaatgag aatgacacac caacctcctt ggaaatggaa
      421 gaaggcgaca ctattgaagt ttaccagcaa cagacgggtg gaaacattta ctaatacttt
      481 tatatattac aaaaataact ttattcttaa taaatattaa aaaaaaaaac aaaactcatg
      541 aaaaatgtaa taattttaat atatatatat ttaaaaaata taaaaattac cagaaagcta
      601 acatccgacc gggccagaga cagcttcaat aacaagcaga aatgaaagga aatacatacg
      661 aaaacctaga ccgaaccatt tacatttcct ctgaaattac aatttaagtt tcattatatt
      721 tttaaatttt tctgttcttc acttactatc aattttatag atttttttat taaagatttg
      781 aaagttcgct gtacacacat ttcaaaccat ttttagtcgt aaaaataaat aaaaatataa
      841 actaaagatt tggtatttta aacgagtcaa ctaataaaag ctagctccaa atgtacatgg
      901 acatgaaaca aa