PREDICTED: Stomoxys calcitrans uncharacterized LOC106092559

LOCUS       XM_013259438             879 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106092559), mRNA.
ACCESSION   XM_013259438
VERSION     XM_013259438.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..879
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..879
                     /gene="LOC106092559"
                     /note="uncharacterized LOC106092559; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:106092559"
     CDS             1..879
                     /gene="LOC106092559"
                     /codon_start=1
                     /product="uncharacterized protein LOC106092559"
                     /protein_id="XP_013114892.1"
                     /db_xref="GeneID:106092559"
                     /translation="MNFKSWLLVLLLGTAVTLQLTEAKDDKQLHKPMPYRLYGKHPQQ
                     GQGQGRSAEILTKLHLLKTPTTTTTLLPPPPPPEGDEGDDNTVVLKEIHLNAKEDPED
                     QHDLELDEEDDGEVEEERSLDLVGDNNDVKEASHGSVRASRPSSRRRRKLKRRRRRRQ
                     MRRRRRRRRHLRRQKKRGGGKRKKRVSKVKRRRRRLRKQKRRLRRRRGSKKGKRRVSR
                     RGGRRKGMKKRKSRKSRKSRKQRKARRRRRMAKKRKRMRRRRRMRRRQRRIRSRRRGG
                     RRGGRRSHRRLRRARL"
ORIGIN      
        1 atgaatttca agagttggtt actcgtgttg ctgcttggta cagctgttac tttgcagttg
       61 acagaggcca aggatgacaa gcaacttcat aagcccatgc cgtataggct gtacggaaag
      121 cacccgcaac aaggacaagg acaaggacgt tctgcagaaa tcttgaccaa attacatttg
      181 ctaaagactc caacgacgac gacaacttta ttgccaccac caccaccgcc tgaaggtgat
      241 gaaggcgatg ataatacagt cgtcctcaag gaaatccatc tgaatgccaa ggaagatccc
      301 gaggaccagc atgacctgga gcttgacgaa gaagacgatg gcgaagtcga agaagagaga
      361 tccttggatc ttgtgggcga taacaacgat gtgaaagaag catcccatgg ttcggttcgt
      421 gctagtcgcc cttcatctag acgtcgcaga aaactgaagc gtcgcagacg cagacgtcaa
      481 atgcgcagac gtagacgcag gcgccgtcat cttcgccgtc aaaagaaacg aggcggtggc
      541 aagcgcaaga agcgtgttag caaagtcaag aggagacgtc gtcgccttag aaaacaaaag
      601 cgacgactaa gaaggagacg tggttccaaa aaaggcaaga gacgtgtttc cagacgcggt
      661 ggccgcagaa aaggcatgaa gaagcgcaaa tcacgcaaat cgcgcaaatc acgtaagcaa
      721 cgcaaagccc ggagacgtag gcgcatggcc aagaaacgta agcgcatgcg cagacgccgt
      781 cgtatgcgcc gtcgccaaag acgcatccga agcagacgac gtggtggacg tcgcggaggt
      841 cgtcgtagcc acagacgtct tagacgtgct cgcttgtaa