Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013259375 916 bp mRNA linear INV 02-SEP-2023 (LOC106092491), mRNA. ACCESSION XM_013259375 VERSION XM_013259375.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013259375.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..916 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..916 /gene="LOC106092491" /note="farnesol dehydrogenase; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:106092491" CDS 37..783 /gene="LOC106092491" /codon_start=1 /product="farnesol dehydrogenase" /protein_id="XP_013114829.2" /db_xref="GeneID:106092491" /translation="MERWQNKIAVVTGASAGIGAATCKALVEKGMIVVGLARRLEKME NQTRLLIEEQYRKNFHSYKCDVGNEESVKEAFAWIDRTFGGIHVLINNAGVCPKSSLL AADNSQAINAVVNTNLLAVVWCTREAFRIMKQHNFDGHIILVNSLAGHKIPHTPGFSF HIYAPAKHALTAMTEVLRQDFLTEGTKIKVTSISPAGVLTEIVSDVSFLAEGPILKTE DIADAIVYCIQTPPHVQIHDMIIRPVGDTT" polyA_site 916 /gene="LOC106092491" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttagtcttaa aagtgctctc aacgaagaca tacaaaatgg aacgttggca aaataaaata 61 gccgtggtta caggagccag tgctggaatt ggagcggcca cttgtaaagc tctggtggaa 121 aagggtatga ttgtggtggg tttggccagg cgacttgaga aaatggaaaa tcaaacaagg 181 ctcctgatag aggaacaata tcgcaaaaat tttcattcct acaaatgtga tgtgggcaat 241 gaggagagtg ttaaagaggc ctttgcttgg attgatcgaa catttggagg aatacatgtt 301 ctcatcaaca atgcgggtgt gtgtcccaag tcctctttgt tggctgcaga taattcgcaa 361 gctattaatg cggttgtcaa caccaatcta ttggcagtgg tctggtgtac ccgtgaggct 421 tttcgcatta tgaaacagca taatttcgat ggccatataa tactggtgaa tagtttggct 481 gggcataaaa ttcctcatac tccaggtttt tcatttcaca tatatgctcc ggcaaagcat 541 gcccttaccg cgatgacaga agtcttaagg caagactttt tgactgaagg cacaaaaatc 601 aaagtgacga gcataagtcc cgccggagta cttacggaaa ttgtaagtga tgtttccttt 661 ctggctgaag gacctatttt gaaaactgaa gatattgctg atgccatagt gtattgcata 721 caaactccac cacatgttca aatacatgac atgataatac gtccagtcgg tgacacaacc 781 taatatacga gtctataaaa ttttaagtgc cctaacatta ttttatacag ccaacagaaa 841 gataaaaacg aaaattgtat atattcatga gtaacgttcg gatggataaa taaatctctt 901 tgatattttt gcacaa