Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans farnesol dehydrogenase


LOCUS       XM_013259375             916 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106092491), mRNA.
ACCESSION   XM_013259375
VERSION     XM_013259375.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013259375.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..916
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..916
                     /gene="LOC106092491"
                     /note="farnesol dehydrogenase; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 4
                     Proteins"
                     /db_xref="GeneID:106092491"
     CDS             37..783
                     /gene="LOC106092491"
                     /codon_start=1
                     /product="farnesol dehydrogenase"
                     /protein_id="XP_013114829.2"
                     /db_xref="GeneID:106092491"
                     /translation="MERWQNKIAVVTGASAGIGAATCKALVEKGMIVVGLARRLEKME
                     NQTRLLIEEQYRKNFHSYKCDVGNEESVKEAFAWIDRTFGGIHVLINNAGVCPKSSLL
                     AADNSQAINAVVNTNLLAVVWCTREAFRIMKQHNFDGHIILVNSLAGHKIPHTPGFSF
                     HIYAPAKHALTAMTEVLRQDFLTEGTKIKVTSISPAGVLTEIVSDVSFLAEGPILKTE
                     DIADAIVYCIQTPPHVQIHDMIIRPVGDTT"
     polyA_site      916
                     /gene="LOC106092491"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttagtcttaa aagtgctctc aacgaagaca tacaaaatgg aacgttggca aaataaaata
       61 gccgtggtta caggagccag tgctggaatt ggagcggcca cttgtaaagc tctggtggaa
      121 aagggtatga ttgtggtggg tttggccagg cgacttgaga aaatggaaaa tcaaacaagg
      181 ctcctgatag aggaacaata tcgcaaaaat tttcattcct acaaatgtga tgtgggcaat
      241 gaggagagtg ttaaagaggc ctttgcttgg attgatcgaa catttggagg aatacatgtt
      301 ctcatcaaca atgcgggtgt gtgtcccaag tcctctttgt tggctgcaga taattcgcaa
      361 gctattaatg cggttgtcaa caccaatcta ttggcagtgg tctggtgtac ccgtgaggct
      421 tttcgcatta tgaaacagca taatttcgat ggccatataa tactggtgaa tagtttggct
      481 gggcataaaa ttcctcatac tccaggtttt tcatttcaca tatatgctcc ggcaaagcat
      541 gcccttaccg cgatgacaga agtcttaagg caagactttt tgactgaagg cacaaaaatc
      601 aaagtgacga gcataagtcc cgccggagta cttacggaaa ttgtaagtga tgtttccttt
      661 ctggctgaag gacctatttt gaaaactgaa gatattgctg atgccatagt gtattgcata
      721 caaactccac cacatgttca aatacatgac atgataatac gtccagtcgg tgacacaacc
      781 taatatacga gtctataaaa ttttaagtgc cctaacatta ttttatacag ccaacagaaa
      841 gataaaaacg aaaattgtat atattcatga gtaacgttcg gatggataaa taaatctctt
      901 tgatattttt gcacaa