Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106092485


LOCUS       XM_013259370             692 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106092485), mRNA.
ACCESSION   XM_013259370
VERSION     XM_013259370.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013259370.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..692
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..692
                     /gene="LOC106092485"
                     /note="uncharacterized LOC106092485; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106092485"
     CDS             6..512
                     /gene="LOC106092485"
                     /codon_start=1
                     /product="uncharacterized protein LOC106092485"
                     /protein_id="XP_013114824.2"
                     /db_xref="GeneID:106092485"
                     /translation="MLIYNSNKRILFLLVTLSQVFRIVKCRAEPEANPGLLGGLAGGA
                     LGSVIGHTLFHKSDDHQHHHTYHATTIDRLETFINGCYRQVVREPDSHNTDDYIETEQ
                     MLCPINVQPPIIGTMPLQPPSLTAGPDPQQVFVLSRRSGTYRNSSNSLMASSLFALLV
                     FTSLSHFM"
     polyA_site      692
                     /gene="LOC106092485"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tcaccatgtt aatttataat agcaataagc gcatattatt tctattagtc actctatctc
       61 aagtattcag aattgtgaaa tgtcgtgctg aacctgaagc caatcctgga ttgcttggtg
      121 gtttggcagg cggtgctctt ggctccgtca ttggtcacac attatttcac aaatccgatg
      181 atcatcagca tcaccatact tatcatgcaa ccactataga tcgactggag acatttatca
      241 atggatgcta tcgacaagtg gtgcgagaac ctgactcaca taacactgat gactatatag
      301 aaacggagca aatgttgtgt cccataaatg tgcagccacc tataatagga acaatgcctt
      361 tgcagccacc ttctttgacc gcaggaccag atcctcagca agtttttgtt ttgtctcgaa
      421 gatctggcac atataggaac agtagcaata gtttaatggc atcaagtctg tttgcattat
      481 tggtttttac ttcattaagc cattttatgt agaacttaac agagacaatt aagctcgtct
      541 tgaaagtgaa aaaaacaaac aaaagaataa attgtttgtc tagcggaaat aagcgaattg
      601 ttaaaattat aatacgagta tatatgtata tcgagttatt atttactaaa ctgtatagaa
      661 aaataaaatt gtagtgccct taccaatgca aa