Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013259370 692 bp mRNA linear INV 02-SEP-2023 (LOC106092485), mRNA. ACCESSION XM_013259370 VERSION XM_013259370.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013259370.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..692 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..692 /gene="LOC106092485" /note="uncharacterized LOC106092485; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106092485" CDS 6..512 /gene="LOC106092485" /codon_start=1 /product="uncharacterized protein LOC106092485" /protein_id="XP_013114824.2" /db_xref="GeneID:106092485" /translation="MLIYNSNKRILFLLVTLSQVFRIVKCRAEPEANPGLLGGLAGGA LGSVIGHTLFHKSDDHQHHHTYHATTIDRLETFINGCYRQVVREPDSHNTDDYIETEQ MLCPINVQPPIIGTMPLQPPSLTAGPDPQQVFVLSRRSGTYRNSSNSLMASSLFALLV FTSLSHFM" polyA_site 692 /gene="LOC106092485" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tcaccatgtt aatttataat agcaataagc gcatattatt tctattagtc actctatctc 61 aagtattcag aattgtgaaa tgtcgtgctg aacctgaagc caatcctgga ttgcttggtg 121 gtttggcagg cggtgctctt ggctccgtca ttggtcacac attatttcac aaatccgatg 181 atcatcagca tcaccatact tatcatgcaa ccactataga tcgactggag acatttatca 241 atggatgcta tcgacaagtg gtgcgagaac ctgactcaca taacactgat gactatatag 301 aaacggagca aatgttgtgt cccataaatg tgcagccacc tataatagga acaatgcctt 361 tgcagccacc ttctttgacc gcaggaccag atcctcagca agtttttgtt ttgtctcgaa 421 gatctggcac atataggaac agtagcaata gtttaatggc atcaagtctg tttgcattat 481 tggtttttac ttcattaagc cattttatgt agaacttaac agagacaatt aagctcgtct 541 tgaaagtgaa aaaaacaaac aaaagaataa attgtttgtc tagcggaaat aagcgaattg 601 ttaaaattat aatacgagta tatatgtata tcgagttatt atttactaaa ctgtatagaa 661 aaataaaatt gtagtgccct taccaatgca aa