Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106092431


LOCUS       XM_013259301             665 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106092431), mRNA.
ACCESSION   XM_013259301
VERSION     XM_013259301.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013259301.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..665
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..665
                     /gene="LOC106092431"
                     /note="uncharacterized LOC106092431; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106092431"
     CDS             36..659
                     /gene="LOC106092431"
                     /codon_start=1
                     /product="uncharacterized protein LOC106092431"
                     /protein_id="XP_013114755.1"
                     /db_xref="GeneID:106092431"
                     /translation="MTKFNINWIFSVVVLIAAANLASASSDAFDLSVLRDILNIYHKK
                     LSVLQCMERSCDPLAHQKMIAIENEMGRELRARLAAIQNFELDSLKADEVLQASIEKL
                     LLAEPKCHDLSYFCPAMETVHLLPKFLSDYITPVQYFTQYGLRCVNLTNVQKAMEILG
                     KSIEYLENEKSNGANYFEEALPAYNYVANEYRKLCDGNFWFGPVNHG"
ORIGIN      
        1 atcaccagtt tagttcaata atcaatcgat tgaatatgac aaaattcaac atcaattgga
       61 tattcagtgt tgtggttctc attgctgccg caaatctggc aagcgcgtct tcagatgcct
      121 tcgatttgag cgtgctcaga gatatactca atatctatca taaaaaactt tcggtactac
      181 aatgcatgga aagaagttgt gatcctttgg ctcatcagaa aatgattgca attgagaatg
      241 aaatgggaag agagttgaga gctaggcttg ccgcaatcca aaattttgaa cttgattccc
      301 ttaaggctga cgaggtactt caggcctcaa ttgagaaatt gttacttgcc gaacccaaat
      361 gccatgacct ttcgtacttt tgcccagcca tggaaacagt ccatttgtta ccaaaattcc
      421 taagtgacta cataactcct gtgcagtact ttactcaata cggactaagg tgtgttaatt
      481 taacaaatgt tcaaaaagct atggagatct tgggcaagtc tattgaatac cttgaaaacg
      541 aaaagtcgaa tggagccaat tacttcgaag aagcattgcc agcctacaat tatgtggcaa
      601 atgaatatcg caagttgtgt gatggaaatt tttggttcgg gcctgtaaac catggctaaa
      661 aacca