Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013259301 665 bp mRNA linear INV 02-SEP-2023 (LOC106092431), mRNA. ACCESSION XM_013259301 VERSION XM_013259301.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013259301.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..665 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..665 /gene="LOC106092431" /note="uncharacterized LOC106092431; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106092431" CDS 36..659 /gene="LOC106092431" /codon_start=1 /product="uncharacterized protein LOC106092431" /protein_id="XP_013114755.1" /db_xref="GeneID:106092431" /translation="MTKFNINWIFSVVVLIAAANLASASSDAFDLSVLRDILNIYHKK LSVLQCMERSCDPLAHQKMIAIENEMGRELRARLAAIQNFELDSLKADEVLQASIEKL LLAEPKCHDLSYFCPAMETVHLLPKFLSDYITPVQYFTQYGLRCVNLTNVQKAMEILG KSIEYLENEKSNGANYFEEALPAYNYVANEYRKLCDGNFWFGPVNHG" ORIGIN 1 atcaccagtt tagttcaata atcaatcgat tgaatatgac aaaattcaac atcaattgga 61 tattcagtgt tgtggttctc attgctgccg caaatctggc aagcgcgtct tcagatgcct 121 tcgatttgag cgtgctcaga gatatactca atatctatca taaaaaactt tcggtactac 181 aatgcatgga aagaagttgt gatcctttgg ctcatcagaa aatgattgca attgagaatg 241 aaatgggaag agagttgaga gctaggcttg ccgcaatcca aaattttgaa cttgattccc 301 ttaaggctga cgaggtactt caggcctcaa ttgagaaatt gttacttgcc gaacccaaat 361 gccatgacct ttcgtacttt tgcccagcca tggaaacagt ccatttgtta ccaaaattcc 421 taagtgacta cataactcct gtgcagtact ttactcaata cggactaagg tgtgttaatt 481 taacaaatgt tcaaaaagct atggagatct tgggcaagtc tattgaatac cttgaaaacg 541 aaaagtcgaa tggagccaat tacttcgaag aagcattgcc agcctacaat tatgtggcaa 601 atgaatatcg caagttgtgt gatggaaatt tttggttcgg gcctgtaaac catggctaaa 661 aacca