Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013259298 1080 bp mRNA linear INV 02-SEP-2023 (LOC106092429), mRNA. ACCESSION XM_013259298 VERSION XM_013259298.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013259298.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1080 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1080 /gene="LOC106092429" /note="uncharacterized LOC106092429; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106092429" CDS 318..947 /gene="LOC106092429" /codon_start=1 /product="uncharacterized protein LOC106092429" /protein_id="XP_013114752.1" /db_xref="GeneID:106092429" /translation="MTKFNINWIFSVVVLIAAANLASASSDAFDLSVLRDILNLFDKK LSVLQCMERSCDPLAHQKMIAIENEMGREMRTRLAAIETFELDSLKADELLQASIEKL LLAEPKCHDLSYSCPGQAIGTIHSLPQFLNDYITPVQYLTQYGLRCVNLTNVQKALEI LGKSIEYLENEKSNGGNYFEEALPAYNYVANEYRKLCDGNFWFGPVIHG" ORIGIN 1 caataagaac tataaaaaat tataagctta taatacacta agacgaaaat gtactctttg 61 ctgaaaactt ccaccaactg ttttattgtc tttcaaattc gcaaaaaata tagttttttt 121 ttgcaaacac ttgaacacac atttgcctcg cctgaacatg tgccagtctt tcaaattctc 181 cttaaggcac ttaaataata aaagaaatat aaatatttag ttataacagg aatgcattgt 241 tcatatggat aatttggtcc tataaaaagc cagatcatgc tatatcacca gtttagttca 301 atatcaatcg atcgaatatg acaaaattca acatcaattg gatattcagt gttgtggttc 361 tcattgctgc cgcaaatctg gcaagcgcgt cttcagatgc cttcgatttg agcgtgctca 421 gggatatact caatttgttt gataaaaaac tttcggtact acaatgcatg gaaagaagtt 481 gtgatccttt ggctcatcag aaaatgattg caattgagaa tgaaatggga agagagatga 541 gaacaaggct tgccgcaatc gaaacttttg aacttgattc ccttaaggct gatgagttac 601 tgcaggcctc aattgagaaa ttgttacttg ccgagcccaa atgccatgac ctgtcgtact 661 catgcccagg ccaagccatc ggaacaattc attcgttacc acaattccta aatgactata 721 ttactcctgt gcagtacctc acccaatacg gactaaggtg tgttaattta acgaatgttc 781 aaaaagcttt ggagatcttg ggcaagtcca ttgaatacct tgaaaacgaa aagtcgaatg 841 gaggcaatta cttcgaggaa gcattgcctg cctacaatta tgtggcaaat gaatatcgca 901 aattgtgtga tggaaatttt tggttcgggc ctgtaatcca tggctaaaaa ctgtgtattc 961 acaattctag tcgaaggcgt agtttcgaat aaaattaaat ttgtggaaaa aatgtattat 1021 agaaaatatc gcttaaattc ggcattaata aaataacatg gactggtgag atggtgaaat