Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106092429


LOCUS       XM_013259298            1080 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106092429), mRNA.
ACCESSION   XM_013259298
VERSION     XM_013259298.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013259298.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1080
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1080
                     /gene="LOC106092429"
                     /note="uncharacterized LOC106092429; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106092429"
     CDS             318..947
                     /gene="LOC106092429"
                     /codon_start=1
                     /product="uncharacterized protein LOC106092429"
                     /protein_id="XP_013114752.1"
                     /db_xref="GeneID:106092429"
                     /translation="MTKFNINWIFSVVVLIAAANLASASSDAFDLSVLRDILNLFDKK
                     LSVLQCMERSCDPLAHQKMIAIENEMGREMRTRLAAIETFELDSLKADELLQASIEKL
                     LLAEPKCHDLSYSCPGQAIGTIHSLPQFLNDYITPVQYLTQYGLRCVNLTNVQKALEI
                     LGKSIEYLENEKSNGGNYFEEALPAYNYVANEYRKLCDGNFWFGPVIHG"
ORIGIN      
        1 caataagaac tataaaaaat tataagctta taatacacta agacgaaaat gtactctttg
       61 ctgaaaactt ccaccaactg ttttattgtc tttcaaattc gcaaaaaata tagttttttt
      121 ttgcaaacac ttgaacacac atttgcctcg cctgaacatg tgccagtctt tcaaattctc
      181 cttaaggcac ttaaataata aaagaaatat aaatatttag ttataacagg aatgcattgt
      241 tcatatggat aatttggtcc tataaaaagc cagatcatgc tatatcacca gtttagttca
      301 atatcaatcg atcgaatatg acaaaattca acatcaattg gatattcagt gttgtggttc
      361 tcattgctgc cgcaaatctg gcaagcgcgt cttcagatgc cttcgatttg agcgtgctca
      421 gggatatact caatttgttt gataaaaaac tttcggtact acaatgcatg gaaagaagtt
      481 gtgatccttt ggctcatcag aaaatgattg caattgagaa tgaaatggga agagagatga
      541 gaacaaggct tgccgcaatc gaaacttttg aacttgattc ccttaaggct gatgagttac
      601 tgcaggcctc aattgagaaa ttgttacttg ccgagcccaa atgccatgac ctgtcgtact
      661 catgcccagg ccaagccatc ggaacaattc attcgttacc acaattccta aatgactata
      721 ttactcctgt gcagtacctc acccaatacg gactaaggtg tgttaattta acgaatgttc
      781 aaaaagcttt ggagatcttg ggcaagtcca ttgaatacct tgaaaacgaa aagtcgaatg
      841 gaggcaatta cttcgaggaa gcattgcctg cctacaatta tgtggcaaat gaatatcgca
      901 aattgtgtga tggaaatttt tggttcgggc ctgtaatcca tggctaaaaa ctgtgtattc
      961 acaattctag tcgaaggcgt agtttcgaat aaaattaaat ttgtggaaaa aatgtattat
     1021 agaaaatatc gcttaaattc ggcattaata aaataacatg gactggtgag atggtgaaat