Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013259272 509 bp mRNA linear INV 02-SEP-2023 (LOC106092413), mRNA. ACCESSION XM_013259272 VERSION XM_013259272.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013259272.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..509 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..509 /gene="LOC106092413" /note="uncharacterized LOC106092413; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106092413" CDS 64..441 /gene="LOC106092413" /codon_start=1 /product="uncharacterized protein LOC106092413" /protein_id="XP_013114726.1" /db_xref="GeneID:106092413" /translation="MKLIYSSAFVLVLMVVGLALTQAGVYTERYFRDEKHPGKCVIQS TVVSPGQSIKHPTMDCAEFTCDNSIGLATIETCDPVSALASPLEKLKDYDRANPPKCS WGNFKNTKATFPKCCEREYTCVF" misc_feature 181..432 /gene="LOC106092413" /note="Single domain von Willebrand factor type C; Region: SVWC; pfam15430" /db_xref="CDD:464713" polyA_site 509 /gene="LOC106092413" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gaagaagtag aagaaatctc agcagttcag tttgcagtct agtctcgagt ggcgaacgac 61 agcatgaaat taatttattc gtctgcattt gttttagtcc ttatggtggt gggtctggct 121 ctgactcagg ctggagtgta cacggaaagg tatttccgcg atgaaaaaca tccgggcaag 181 tgtgttatac aaagtacggt cgttagtccg ggacaaagca taaaacatcc aacaatggac 241 tgtgccgagt tcacctgtga caattccatt ggtttggcga caattgaaac ctgtgatcct 301 gtatcggctt tggcttcacc cctggagaaa cttaaagatt atgaccgcgc caatccacca 361 aagtgctcat ggggtaattt caagaatacc aaagcaacgt tccccaaatg ctgtgaacgc 421 gaatacacgt gcgtttttta gtaaccaact tgacaagaga aatggtgaag gatttaaaat 481 ggaaataaaa atataaatta aactttaaa