Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106092413


LOCUS       XM_013259272             509 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106092413), mRNA.
ACCESSION   XM_013259272
VERSION     XM_013259272.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013259272.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..509
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..509
                     /gene="LOC106092413"
                     /note="uncharacterized LOC106092413; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:106092413"
     CDS             64..441
                     /gene="LOC106092413"
                     /codon_start=1
                     /product="uncharacterized protein LOC106092413"
                     /protein_id="XP_013114726.1"
                     /db_xref="GeneID:106092413"
                     /translation="MKLIYSSAFVLVLMVVGLALTQAGVYTERYFRDEKHPGKCVIQS
                     TVVSPGQSIKHPTMDCAEFTCDNSIGLATIETCDPVSALASPLEKLKDYDRANPPKCS
                     WGNFKNTKATFPKCCEREYTCVF"
     misc_feature    181..432
                     /gene="LOC106092413"
                     /note="Single domain von Willebrand factor type C; Region:
                     SVWC; pfam15430"
                     /db_xref="CDD:464713"
     polyA_site      509
                     /gene="LOC106092413"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gaagaagtag aagaaatctc agcagttcag tttgcagtct agtctcgagt ggcgaacgac
       61 agcatgaaat taatttattc gtctgcattt gttttagtcc ttatggtggt gggtctggct
      121 ctgactcagg ctggagtgta cacggaaagg tatttccgcg atgaaaaaca tccgggcaag
      181 tgtgttatac aaagtacggt cgttagtccg ggacaaagca taaaacatcc aacaatggac
      241 tgtgccgagt tcacctgtga caattccatt ggtttggcga caattgaaac ctgtgatcct
      301 gtatcggctt tggcttcacc cctggagaaa cttaaagatt atgaccgcgc caatccacca
      361 aagtgctcat ggggtaattt caagaatacc aaagcaacgt tccccaaatg ctgtgaacgc
      421 gaatacacgt gcgtttttta gtaaccaact tgacaagaga aatggtgaag gatttaaaat
      481 ggaaataaaa atataaatta aactttaaa