PREDICTED: Stomoxys calcitrans elongation of very long chain fatty

LOCUS       XM_013259233             917 bp    mRNA    linear   INV 02-SEP-2023
            acids protein 1-like (LOC106092388), mRNA.
ACCESSION   XM_013259233
VERSION     XM_013259233.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013259233.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..917
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..917
                     /gene="LOC106092388"
                     /note="elongation of very long chain fatty acids protein
                     1-like; Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 14 Proteins"
                     /db_xref="GeneID:106092388"
     CDS             71..883
                     /gene="LOC106092388"
                     /codon_start=1
                     /product="elongation of very long chain fatty acids
                     protein 1-like"
                     /protein_id="XP_013114687.1"
                     /db_xref="GeneID:106092388"
                     /translation="MLILKLLIRELKGHFSIAGHDPRMTDLTLVNSYLNVILLLVSYV
                     IFVKKIGPNYMAKQKAYKLKSLMRLYNIGQVMLNIYIFIGFMRHYIQHPLYNWLCMSI
                     PKTDVSTPTMRLLHITYMCYMSKVLDLSDTVIFVLRKKNRQVSFLHVYHHVTMVWASF
                     LYHNKFFGSTFTAIGAVNSFVHILMYTYYLLSAMDIKINLDAWKPRLTEIQIIQFCYY
                     CLKFAATLLNNTCGMSVFWLSLLLLQNMFITLMFCFFYYKTYIVKERANKIR"
     misc_feature    152..874
                     /gene="LOC106092388"
                     /note="GNS1/SUR4 family; Region: ELO; pfam01151"
                     /db_xref="CDD:460083"
     polyA_site      917
                     /gene="LOC106092388"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 actggacaat tcatcagtcg ttcggaatcc tcttaacgag aacaaagtgt tatactgacg
       61 tattttgaaa atgcttattt taaaattact tatacgcgaa ctgaaaggtc atttctccat
      121 agcaggacat gatccccgaa tgaccgatct aaccttggtc aatagttatt tgaatgtcat
      181 actgctcttg gtgtcctatg tgatttttgt gaaaaaaatt ggtcccaatt atatggccaa
      241 acaaaaggca tacaaactta aatctctaat gagactttat aatattggac aagttatgct
      301 gaatatttat atcttcattg ggttcatgcg gcactacatt caacatcctc tctacaattg
      361 gttatgcatg agcataccta agacagacgt ttccacaccc accatgagac tattacacat
      421 aacatacatg tgctacatga gcaaagtctt ggatctgtca gacactgtga tatttgtatt
      481 gcgtaagaaa aatcgtcagg tatcatttct acatgtatac catcatgtca caatggtatg
      541 ggccagtttt ttatatcaca ataaattctt tggttcaaca tttaccgcaa ttggagctgt
      601 gaactcattc gtgcacattc ttatgtatac ctattatctg ctctcagcca tggatattaa
      661 aataaatttg gatgcatgga aacctcgact cacagaaata caaattatac aattttgtta
      721 ttactgcctg aagtttgcag ctacactcct gaacaatacc tgtggcatgt ccgttttttg
      781 gttatcatta ttgttgttgc aaaatatgtt tatcactttg atgttttgtt tcttctatta
      841 taaaacgtat attgtcaaag agagggcgaa taaaattaga taagttattc ttaattaaat
      901 caaaaatgaa attttta