PREDICTED: Stomoxys calcitrans elongation of very long chain fatty

LOCUS       XM_013259231             903 bp    mRNA    linear   INV 02-SEP-2023
            acids protein AAEL008004-like (LOC106092386), mRNA.
ACCESSION   XM_013259231
VERSION     XM_013259231.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013259231.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..903
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..903
                     /gene="LOC106092386"
                     /note="elongation of very long chain fatty acids protein
                     AAEL008004-like; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 4 Proteins"
                     /db_xref="GeneID:106092386"
     CDS             74..868
                     /gene="LOC106092386"
                     /codon_start=1
                     /product="elongation of very long chain fatty acids
                     protein AAEL008004-like"
                     /protein_id="XP_013114685.1"
                     /db_xref="GeneID:106092386"
                     /translation="MLGELKEHFLTAGGRDPRTRDLPFCTSYRSITLIIVVYVLLVKK
                     IGPAFMAKRKPYNIRWLISLYNFLQVIFNGYLFITTTKYFLFHPKYSWSCMAFDHEET
                     SEETMGLRRMGFLYFLNKVADCFDTVFFVLTKKYGHISVLHVYHHATMVWASFSYINW
                     MLGSQFTIVGYLNTLVHMIMYFYYLLASLKLNINLSRWKKHLTQFQLLQFVYYCLKVI
                     VPLTNNWCNLSRTWLWAVLAENVIMIVLFSNFYYKTYIVKKPKAKK"
     misc_feature    140..862
                     /gene="LOC106092386"
                     /note="GNS1/SUR4 family; Region: ELO; pfam01151"
                     /db_xref="CDD:460083"
     polyA_site      903
                     /gene="LOC106092386"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cttggacaaa tgacttgtgt gtttcagtcg ccattgcctt tagtccattt cgattatcct
       61 atagtgcaac actatgctcg gcgaactaaa agaacatttc ttaacagctg gtggaagaga
      121 tcctcgcacc cgggatttac ctttctgcac cagttacaga tctatcaccc ttataatagt
      181 ggtctatgta ctacttgtga aaaaaatcgg tccagctttt atggctaaac gaaagccata
      241 caacattaga tggcttatat cgttgtataa cttcctgcaa gtgattttta atggatattt
      301 gtttataacg actacgaaat attttttatt tcaccccaaa tattcatgga gttgtatggc
      361 atttgaccat gaggagacta gtgaagaaac tatgggtctc cggagaatgg gatttcttta
      421 ttttctaaac aaagttgccg actgcttcga cacagtattc tttgttttga ccaaaaaata
      481 cggtcacatt tcggtgttgc atgtctacca tcatgccaca atggtttggg ccagcttcag
      541 ctatattaat tggatgttag gttcccaatt tacaatcgtc ggatatctaa atacactggt
      601 tcacatgatc atgtacttct attatttatt ggcttctcta aagctcaata tcaatctgag
      661 ccgatggaag aaacatctaa cacaattcca actattgcaa tttgtctatt attgcttgaa
      721 agtaatagtt cccctgacaa acaattggtg taatctctcc aggacttggc tatgggccgt
      781 gctggcggag aatgttatta tgatagtttt gttttccaat ttttattata agacatatat
      841 tgtgaaaaaa ccgaaagcaa aaaaatagaa aagaaaaaaa tccaaacaaa agcattaccg
      901 aaa