Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106092370


LOCUS       XM_013259209             617 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106092370), mRNA.
ACCESSION   XM_013259209
VERSION     XM_013259209.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013259209.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..617
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..617
                     /gene="LOC106092370"
                     /note="uncharacterized LOC106092370; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106092370"
     CDS             75..524
                     /gene="LOC106092370"
                     /codon_start=1
                     /product="uncharacterized protein LOC106092370"
                     /protein_id="XP_013114663.2"
                     /db_xref="GeneID:106092370"
                     /translation="MLKSVKSSWMCSIFLLFNLVSGQYFELKSDNVTVWHDDLEDILS
                     VEDNSWHKDMEETRTLVSLSTPEPVDYDDYVAVAETYIDNWHGSPFESTIGYVTPLVG
                     PASEIVIPLNDIFNIRRKRTDSLGWQYDIPKNCKPVSMGTANRVTKG"
     polyA_site      617
                     /gene="LOC106092370"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cgttcttaca ttctcgctta agttcttggt ggaaaaagaa ttaaatttcc taaataaaaa
       61 attatttaga aaaaatgtta aaatccgtaa aatcttcatg gatgtgtagc atattcttgc
      121 tattcaactt agtttcgggg caatactttg aactaaaatc ggataatgta accgtatggc
      181 atgacgattt agaggatatt ttatctgttg aggataacag ttggcataaa gatatggaag
      241 aaactcgtac tttggtttca ttatcaacgc cagaaccagt agactatgat gattatgttg
      301 cagtggcaga gacgtatata gataactggc atggcagtcc ctttgaatcg accattggtt
      361 atgtaacacc cttggtgggt cccgcctccg aaattgttat accactaaat gatattttta
      421 atattagaag gaaacgcaca gatagtttgg gttggcaata cgacatacct aaaaattgca
      481 aacctgttag tatgggcaca gcaaatcgag tcactaaggg ttaataatta gtgaacataa
      541 actaaaataa aaataaaata tataaatgtt gtaaagtttt tacaaataat atatgaaatg
      601 tattgagtaa caaagta