Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans sperm mitochondrial-associated


LOCUS       XM_013259196             702 bp    mRNA    linear   INV 02-SEP-2023
            cysteine-rich protein-like (LOC106092361), transcript variant X2,
            mRNA.
ACCESSION   XM_013259196
VERSION     XM_013259196.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013259196.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..702
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..702
                     /gene="LOC106092361"
                     /note="sperm mitochondrial-associated cysteine-rich
                     protein-like; Derived by automated computational analysis
                     using gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins"
                     /db_xref="GeneID:106092361"
     CDS             134..427
                     /gene="LOC106092361"
                     /codon_start=1
                     /product="sperm mitochondrial-associated cysteine-rich
                     protein-like"
                     /protein_id="XP_013114650.2"
                     /db_xref="GeneID:106092361"
                     /translation="MCDACCAPCGPCCACEPCCPPSQPKSCQSHELRAGIMYSTCDCF
                     RRNGLQDKCPRALCQGRSACMSFPKPNCCPSKFPLRFANMTMGVRKRSGNACS"
     polyA_site      702
                     /gene="LOC106092361"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttttctaaat ttaaactaga acgtcacgtc attcctcttt cataaaactt tttgaaaaat
       61 ctataaaaaa aaattcaaaa ttttcctttc caaatcttga ctatttttga taaaaaaaaa
      121 attccatctc aacatgtgcg atgcttgctg cgctccctgt ggaccatgct gtgcatgtga
      181 accatgctgt ccaccctctc agcccaaatc gtgtcagagc catgaattgc gtgctggcat
      241 catgtacagc acttgtgatt gttttcgacg taacggcctt caggataaat gtcctcgtgc
      301 tttgtgtcaa ggtcgttcag cttgtatgtc ttttcccaaa cccaattgct gtccatctaa
      361 atttcctttg cgttttgcca atatgactat gggagtaagg aaacgcagtg gtaacgcatg
      421 ctcataaaat tcagaatctt agcgaggatc atgtgatcgt tgatgcggaa tctcgaaaca
      481 tgtgcagttc tagctactta attacctctt ccaaagtgtt gtttaacgct gtgtatgggc
      541 attttataga ttcaaccata aatgcaagta aaataccacc gactccattt aagtaaattt
      601 ttttcgaaga aataaatgaa tcacaatcta agaatatatc aacatatcat taaacgtgga
      661 aaaataaatg aagattctct taccgcctgt gtctgaatat aa