Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013259196 702 bp mRNA linear INV 02-SEP-2023 cysteine-rich protein-like (LOC106092361), transcript variant X2, mRNA. ACCESSION XM_013259196 VERSION XM_013259196.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013259196.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..702 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..702 /gene="LOC106092361" /note="sperm mitochondrial-associated cysteine-rich protein-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:106092361" CDS 134..427 /gene="LOC106092361" /codon_start=1 /product="sperm mitochondrial-associated cysteine-rich protein-like" /protein_id="XP_013114650.2" /db_xref="GeneID:106092361" /translation="MCDACCAPCGPCCACEPCCPPSQPKSCQSHELRAGIMYSTCDCF RRNGLQDKCPRALCQGRSACMSFPKPNCCPSKFPLRFANMTMGVRKRSGNACS" polyA_site 702 /gene="LOC106092361" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttttctaaat ttaaactaga acgtcacgtc attcctcttt cataaaactt tttgaaaaat 61 ctataaaaaa aaattcaaaa ttttcctttc caaatcttga ctatttttga taaaaaaaaa 121 attccatctc aacatgtgcg atgcttgctg cgctccctgt ggaccatgct gtgcatgtga 181 accatgctgt ccaccctctc agcccaaatc gtgtcagagc catgaattgc gtgctggcat 241 catgtacagc acttgtgatt gttttcgacg taacggcctt caggataaat gtcctcgtgc 301 tttgtgtcaa ggtcgttcag cttgtatgtc ttttcccaaa cccaattgct gtccatctaa 361 atttcctttg cgttttgcca atatgactat gggagtaagg aaacgcagtg gtaacgcatg 421 ctcataaaat tcagaatctt agcgaggatc atgtgatcgt tgatgcggaa tctcgaaaca 481 tgtgcagttc tagctactta attacctctt ccaaagtgtt gtttaacgct gtgtatgggc 541 attttataga ttcaaccata aatgcaagta aaataccacc gactccattt aagtaaattt 601 ttttcgaaga aataaatgaa tcacaatcta agaatatatc aacatatcat taaacgtgga 661 aaaataaatg aagattctct taccgcctgt gtctgaatat aa