Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013259195 773 bp mRNA linear INV 02-SEP-2023 cysteine-rich protein-like (LOC106092361), transcript variant X1, mRNA. ACCESSION XM_013259195 VERSION XM_013259195.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013259195.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..773 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..773 /gene="LOC106092361" /note="sperm mitochondrial-associated cysteine-rich protein-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:106092361" CDS 205..498 /gene="LOC106092361" /codon_start=1 /product="sperm mitochondrial-associated cysteine-rich protein-like" /protein_id="XP_013114649.2" /db_xref="GeneID:106092361" /translation="MCDACCAPCGPCCACEPCCPPSQPKSCQSHELRAGIMYSTCDCF RRNGLQDKCPRALCQGRSACMSFPKPNCCPSKFPLRFANMTMGVRKRSGNACS" polyA_site 773 /gene="LOC106092361" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tccttattca ttttctaaat ttaaactaga acgtcacgtc attcctcttt cataaaactt 61 tttgaaaaat ctataaaaaa aaattcaaaa ttttcctttc caaatcttga ctattgtgag 121 ccaaatcttg tggaacttct gtcctagtgt ccttaagaat ttttcatatt ttctagtttg 181 ataaaaaaaa aattccatct caacatgtgc gatgcttgct gcgctccctg tggaccatgc 241 tgtgcatgtg aaccatgctg tccaccctct cagcccaaat cgtgtcagag ccatgaattg 301 cgtgctggca tcatgtacag cacttgtgat tgttttcgac gtaacggcct tcaggataaa 361 tgtcctcgtg ctttgtgtca aggtcgttca gcttgtatgt cttttcccaa acccaattgc 421 tgtccatcta aatttccttt gcgttttgcc aatatgacta tgggagtaag gaaacgcagt 481 ggtaacgcat gctcataaaa ttcagaatct tagcgaggat catgtgatcg ttgatgcgga 541 atctcgaaac atgtgcagtt ctagctactt aattacctct tccaaagtgt tgtttaacgc 601 tgtgtatggg cattttatag attcaaccat aaatgcaagt aaaataccac cgactccatt 661 taagtaaatt tttttcgaag aaataaatga atcacaatct aagaatatat caacatatca 721 ttaaacgtgg aaaaataaat gaagattctc ttaccgcctg tgtctgaata taa