Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans sperm mitochondrial-associated


LOCUS       XM_013259195             773 bp    mRNA    linear   INV 02-SEP-2023
            cysteine-rich protein-like (LOC106092361), transcript variant X1,
            mRNA.
ACCESSION   XM_013259195
VERSION     XM_013259195.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013259195.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..773
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..773
                     /gene="LOC106092361"
                     /note="sperm mitochondrial-associated cysteine-rich
                     protein-like; Derived by automated computational analysis
                     using gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins"
                     /db_xref="GeneID:106092361"
     CDS             205..498
                     /gene="LOC106092361"
                     /codon_start=1
                     /product="sperm mitochondrial-associated cysteine-rich
                     protein-like"
                     /protein_id="XP_013114649.2"
                     /db_xref="GeneID:106092361"
                     /translation="MCDACCAPCGPCCACEPCCPPSQPKSCQSHELRAGIMYSTCDCF
                     RRNGLQDKCPRALCQGRSACMSFPKPNCCPSKFPLRFANMTMGVRKRSGNACS"
     polyA_site      773
                     /gene="LOC106092361"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tccttattca ttttctaaat ttaaactaga acgtcacgtc attcctcttt cataaaactt
       61 tttgaaaaat ctataaaaaa aaattcaaaa ttttcctttc caaatcttga ctattgtgag
      121 ccaaatcttg tggaacttct gtcctagtgt ccttaagaat ttttcatatt ttctagtttg
      181 ataaaaaaaa aattccatct caacatgtgc gatgcttgct gcgctccctg tggaccatgc
      241 tgtgcatgtg aaccatgctg tccaccctct cagcccaaat cgtgtcagag ccatgaattg
      301 cgtgctggca tcatgtacag cacttgtgat tgttttcgac gtaacggcct tcaggataaa
      361 tgtcctcgtg ctttgtgtca aggtcgttca gcttgtatgt cttttcccaa acccaattgc
      421 tgtccatcta aatttccttt gcgttttgcc aatatgacta tgggagtaag gaaacgcagt
      481 ggtaacgcat gctcataaaa ttcagaatct tagcgaggat catgtgatcg ttgatgcgga
      541 atctcgaaac atgtgcagtt ctagctactt aattacctct tccaaagtgt tgtttaacgc
      601 tgtgtatggg cattttatag attcaaccat aaatgcaagt aaaataccac cgactccatt
      661 taagtaaatt tttttcgaag aaataaatga atcacaatct aagaatatat caacatatca
      721 ttaaacgtgg aaaaataaat gaagattctc ttaccgcctg tgtctgaata taa