Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans L-xylulose reductase (LOC106092153),


LOCUS       XM_013258926             952 bp    mRNA    linear   INV 02-SEP-2023
            mRNA.
ACCESSION   XM_013258926
VERSION     XM_013258926.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013258926.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..952
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..952
                     /gene="LOC106092153"
                     /note="L-xylulose reductase; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 22
                     Proteins"
                     /db_xref="GeneID:106092153"
     CDS             56..781
                     /gene="LOC106092153"
                     /codon_start=1
                     /product="L-xylulose reductase"
                     /protein_id="XP_013114380.2"
                     /db_xref="GeneID:106092153"
                     /translation="MYENMKNKTILVTGAGAGIGNDLCKQLAEAGANVVAVARSSEQL
                     KELRSFNSSIKTFQVDLKDWSQVRQTLANVPALDGLVNNAGIAIIRPFTELTEQDFDD
                     TFDVNIRAVFNVTQTVLPKLKENSSVVMVSSLAASRSFDGHAVYSATKAAVDSLTRSL
                     ALELGPRKIRVNSVNPTVVLTKMGRDNWSDPAKAGPLLAHIPQRRFCEVQEVVDAIVF
                     LLSDKSSFVNGHHLNLEGGYSVS"
     polyA_site      952
                     /gene="LOC106092153"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cacatatcat tctagttagc tactctgttt tgtttggtgt ggtaagaccg gtactatgta
       61 cgagaatatg aagaacaaaa caattcttgt gaccggcgct ggggcaggta taggcaatga
      121 tttgtgcaaa caacttgcgg aggctggagc caatgttgtc gcggtggcac ggtctagtga
      181 acaattgaag gaattgcggt cattcaattc atccatcaaa acattccagg ttgatcttaa
      241 agattggtct caagtacgcc agactttggc aaatgtgccc gcccttgatg gattggttaa
      301 caatgctggc attgcaatca tcagaccatt tacagagtta accgagcaag attttgatga
      361 cacttttgat gtcaacatca gggcagtttt caatgtgaca caaaccgtac tgcccaaatt
      421 gaaagaaaat tccagcgttg tcatggtatc atctctagca gcatcgcgat cctttgatgg
      481 ccatgcggtc tatagtgcaa caaaagcagc agttgattcc cttacacgat ctttagctct
      541 cgagttggga ccaaggaaaa tacgggtgaa ttcagttaac cccaccgttg tactaactaa
      601 aatgggccgg gataattgga gcgatcccgc caaagctggc cctcttttgg cccatatacc
      661 acaacgaaga ttttgcgaag tccaagaagt tgtagatgcc attgtctttt tattgagcga
      721 caaatcgagt tttgtcaatg ggcatcattt gaatttggaa ggaggctatt cggtttcttg
      781 agtcttaaaa aaaaccacaa tgttccatta ttttttcttt tattttaata tatgattata
      841 atccgtgtgt attcacaaga caagaaaaaa caagaatctt gaaacgaatg taagtaaaca
      901 tatatgagtg tgtgattata cattattaaa tgtgtgtatc ttaacttaat aa