Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013258926 952 bp mRNA linear INV 02-SEP-2023 mRNA. ACCESSION XM_013258926 VERSION XM_013258926.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013258926.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..952 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..952 /gene="LOC106092153" /note="L-xylulose reductase; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 22 Proteins" /db_xref="GeneID:106092153" CDS 56..781 /gene="LOC106092153" /codon_start=1 /product="L-xylulose reductase" /protein_id="XP_013114380.2" /db_xref="GeneID:106092153" /translation="MYENMKNKTILVTGAGAGIGNDLCKQLAEAGANVVAVARSSEQL KELRSFNSSIKTFQVDLKDWSQVRQTLANVPALDGLVNNAGIAIIRPFTELTEQDFDD TFDVNIRAVFNVTQTVLPKLKENSSVVMVSSLAASRSFDGHAVYSATKAAVDSLTRSL ALELGPRKIRVNSVNPTVVLTKMGRDNWSDPAKAGPLLAHIPQRRFCEVQEVVDAIVF LLSDKSSFVNGHHLNLEGGYSVS" polyA_site 952 /gene="LOC106092153" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cacatatcat tctagttagc tactctgttt tgtttggtgt ggtaagaccg gtactatgta 61 cgagaatatg aagaacaaaa caattcttgt gaccggcgct ggggcaggta taggcaatga 121 tttgtgcaaa caacttgcgg aggctggagc caatgttgtc gcggtggcac ggtctagtga 181 acaattgaag gaattgcggt cattcaattc atccatcaaa acattccagg ttgatcttaa 241 agattggtct caagtacgcc agactttggc aaatgtgccc gcccttgatg gattggttaa 301 caatgctggc attgcaatca tcagaccatt tacagagtta accgagcaag attttgatga 361 cacttttgat gtcaacatca gggcagtttt caatgtgaca caaaccgtac tgcccaaatt 421 gaaagaaaat tccagcgttg tcatggtatc atctctagca gcatcgcgat cctttgatgg 481 ccatgcggtc tatagtgcaa caaaagcagc agttgattcc cttacacgat ctttagctct 541 cgagttggga ccaaggaaaa tacgggtgaa ttcagttaac cccaccgttg tactaactaa 601 aatgggccgg gataattgga gcgatcccgc caaagctggc cctcttttgg cccatatacc 661 acaacgaaga ttttgcgaag tccaagaagt tgtagatgcc attgtctttt tattgagcga 721 caaatcgagt tttgtcaatg ggcatcattt gaatttggaa ggaggctatt cggtttcttg 781 agtcttaaaa aaaaccacaa tgttccatta ttttttcttt tattttaata tatgattata 841 atccgtgtgt attcacaaga caagaaaaaa caagaatctt gaaacgaatg taagtaaaca 901 tatatgagtg tgtgattata cattattaaa tgtgtgtatc ttaacttaat aa