Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106092149


LOCUS       XM_013258921             696 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106092149), mRNA.
ACCESSION   XM_013258921
VERSION     XM_013258921.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013258921.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..696
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..696
                     /gene="LOC106092149"
                     /note="uncharacterized LOC106092149; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 5
                     Proteins"
                     /db_xref="GeneID:106092149"
     CDS             19..654
                     /gene="LOC106092149"
                     /codon_start=1
                     /product="uncharacterized protein LOC106092149"
                     /protein_id="XP_013114375.2"
                     /db_xref="GeneID:106092149"
                     /translation="MKFTLFALLAVLCLVSVRANVEITAPIEEVDFEYIAKNVAEDVV
                     DIDTQVSWFGIYFVIHKALTTLKGVNCTIKEVYAIKAAAQNFVADVQACGGEVSKKLQ
                     QLIDTCNDIISTSNDIIHLNENICGNSADQDTSAVSPQKTTTPWKCFWKLLSKTLQLK
                     GQVKKAIRLIRQIPSVPGDAGTCVNNALDTLSSAFNQFPSNVKTCSKLTKN"
ORIGIN      
        1 ctaaaaacag agctcgtcat gaaattcaca ctttttgcct tattggctgt actgtgcctg
       61 gtatctgtga gagccaatgt tgaaataacc gctcccatcg aagaggtcga ttttgaatat
      121 attgccaaaa atgtggccga agatgttgtc gatattgata ctcaggtttc atggttcgga
      181 atttactttg tcatccacaa ggccttaacc acattgaagg gtgtcaactg caccatcaaa
      241 gaggtttatg ccattaaagc tgctgctcaa aacttcgtcg ctgacgttca agcctgtggc
      301 ggtgaggtgt ccaagaaact tcaacaactg attgatacct gcaatgacat tatatcgacc
      361 tctaatgaca tcattcattt gaatgaaaat atctgtggca attctgcgga tcaggataca
      421 tcagcagtct ctcctcaaaa gactacaacc ccatggaagt gcttctggaa gctgttgtcc
      481 aaaacattgc aattgaaggg tcaagtaaag aaagccattc gcttgattag gcaaatacct
      541 tcggtgcctg gagatgctgg tacctgtgtg aataatgccc tggatactct aagtagtgct
      601 ttcaatcagt ttccatcgaa tgtaaaaact tgctcgaaat tgaccaagaa ttaaagaccg
      661 ggttgaaatc catttattat catctgatca tttata