Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013258921 696 bp mRNA linear INV 02-SEP-2023 (LOC106092149), mRNA. ACCESSION XM_013258921 VERSION XM_013258921.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013258921.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..696 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..696 /gene="LOC106092149" /note="uncharacterized LOC106092149; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:106092149" CDS 19..654 /gene="LOC106092149" /codon_start=1 /product="uncharacterized protein LOC106092149" /protein_id="XP_013114375.2" /db_xref="GeneID:106092149" /translation="MKFTLFALLAVLCLVSVRANVEITAPIEEVDFEYIAKNVAEDVV DIDTQVSWFGIYFVIHKALTTLKGVNCTIKEVYAIKAAAQNFVADVQACGGEVSKKLQ QLIDTCNDIISTSNDIIHLNENICGNSADQDTSAVSPQKTTTPWKCFWKLLSKTLQLK GQVKKAIRLIRQIPSVPGDAGTCVNNALDTLSSAFNQFPSNVKTCSKLTKN" ORIGIN 1 ctaaaaacag agctcgtcat gaaattcaca ctttttgcct tattggctgt actgtgcctg 61 gtatctgtga gagccaatgt tgaaataacc gctcccatcg aagaggtcga ttttgaatat 121 attgccaaaa atgtggccga agatgttgtc gatattgata ctcaggtttc atggttcgga 181 atttactttg tcatccacaa ggccttaacc acattgaagg gtgtcaactg caccatcaaa 241 gaggtttatg ccattaaagc tgctgctcaa aacttcgtcg ctgacgttca agcctgtggc 301 ggtgaggtgt ccaagaaact tcaacaactg attgatacct gcaatgacat tatatcgacc 361 tctaatgaca tcattcattt gaatgaaaat atctgtggca attctgcgga tcaggataca 421 tcagcagtct ctcctcaaaa gactacaacc ccatggaagt gcttctggaa gctgttgtcc 481 aaaacattgc aattgaaggg tcaagtaaag aaagccattc gcttgattag gcaaatacct 541 tcggtgcctg gagatgctgg tacctgtgtg aataatgccc tggatactct aagtagtgct 601 ttcaatcagt ttccatcgaa tgtaaaaact tgctcgaaat tgaccaagaa ttaaagaccg 661 ggttgaaatc catttattat catctgatca tttata