Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106092148


LOCUS       XM_013258920             706 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106092148), mRNA.
ACCESSION   XM_013258920
VERSION     XM_013258920.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013258920.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..706
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..706
                     /gene="LOC106092148"
                     /note="uncharacterized LOC106092148; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:106092148"
     CDS             46..663
                     /gene="LOC106092148"
                     /codon_start=1
                     /product="uncharacterized protein LOC106092148"
                     /protein_id="XP_013114374.1"
                     /db_xref="GeneID:106092148"
                     /translation="MKFTIVAVVVALCLAGANANAIGFQVPHPNEFEYVPNDFANDME
                     GIEDLTIFSSFYWIAKAALKTLKGVNCTIKQVMNTRSVTQNFIPSIQACGTDAVSAFT
                     NVFTSAQSVITTCDNIINLNEQVCNNDVSTNGQTSTPSSCSTKLFGQLTTLYVQIQKT
                     KAAIKKLPTVPSDAVACTNSAVTTLTTAFTNFPSNIKSCSKLTSS"
ORIGIN      
        1 aataatttta aacgaaattc gttaaagttt gcacgcaaaa tcaaaatgaa attcacaatt
       61 gtcgcagttg tggtagcctt gtgcttggcc ggtgccaacg ccaatgccat cggcttccaa
      121 gttccccacc ccaatgagtt tgaatatgtt cccaacgact ttgctaacga tatggagggc
      181 attgaagatt taaccatttt cagctctttc tattggatag ccaaggctgc cttgaagaca
      241 ctcaagggtg tcaactgcac catcaaacag gtgatgaaca cccgaagtgt gacccaaaac
      301 ttcattccca gcattcaagc atgtggcact gatgctgtat cagcttttac caatgttttt
      361 acctctgccc aatcggtcat caccacctgc gacaacatca tcaacttaaa tgaacaagtt
      421 tgcaacaatg acgtgtctac caatggccaa acctccaccc caagctcatg ctccactaaa
      481 ctcttcggcc aattgaccac tttgtacgtt caaatccaga agacaaaggc tgctatcaag
      541 aagttgccca ctgtgccatc tgacgccgtc gcctgcacca atagtgccgt caccactttg
      601 accactgcct tcaccaactt cccaagtaac atcaagagct gctccaaatt gaccagcagc
      661 taagaaggaa cgtgcaatcc caccgaattc taacgaaaaa taaatg