Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013258920 706 bp mRNA linear INV 02-SEP-2023 (LOC106092148), mRNA. ACCESSION XM_013258920 VERSION XM_013258920.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013258920.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..706 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..706 /gene="LOC106092148" /note="uncharacterized LOC106092148; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:106092148" CDS 46..663 /gene="LOC106092148" /codon_start=1 /product="uncharacterized protein LOC106092148" /protein_id="XP_013114374.1" /db_xref="GeneID:106092148" /translation="MKFTIVAVVVALCLAGANANAIGFQVPHPNEFEYVPNDFANDME GIEDLTIFSSFYWIAKAALKTLKGVNCTIKQVMNTRSVTQNFIPSIQACGTDAVSAFT NVFTSAQSVITTCDNIINLNEQVCNNDVSTNGQTSTPSSCSTKLFGQLTTLYVQIQKT KAAIKKLPTVPSDAVACTNSAVTTLTTAFTNFPSNIKSCSKLTSS" ORIGIN 1 aataatttta aacgaaattc gttaaagttt gcacgcaaaa tcaaaatgaa attcacaatt 61 gtcgcagttg tggtagcctt gtgcttggcc ggtgccaacg ccaatgccat cggcttccaa 121 gttccccacc ccaatgagtt tgaatatgtt cccaacgact ttgctaacga tatggagggc 181 attgaagatt taaccatttt cagctctttc tattggatag ccaaggctgc cttgaagaca 241 ctcaagggtg tcaactgcac catcaaacag gtgatgaaca cccgaagtgt gacccaaaac 301 ttcattccca gcattcaagc atgtggcact gatgctgtat cagcttttac caatgttttt 361 acctctgccc aatcggtcat caccacctgc gacaacatca tcaacttaaa tgaacaagtt 421 tgcaacaatg acgtgtctac caatggccaa acctccaccc caagctcatg ctccactaaa 481 ctcttcggcc aattgaccac tttgtacgtt caaatccaga agacaaaggc tgctatcaag 541 aagttgccca ctgtgccatc tgacgccgtc gcctgcacca atagtgccgt caccactttg 601 accactgcct tcaccaactt cccaagtaac atcaagagct gctccaaatt gaccagcagc 661 taagaaggaa cgtgcaatcc caccgaattc taacgaaaaa taaatg