Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans B-cell CLL/lymphoma 7 protein family


LOCUS       XM_013258657             689 bp    mRNA    linear   INV 02-SEP-2023
            member B (LOC106091944), mRNA.
ACCESSION   XM_013258657
VERSION     XM_013258657.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013258657.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..689
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..689
                     /gene="LOC106091944"
                     /note="B-cell CLL/lymphoma 7 protein family member B;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 8 Proteins"
                     /db_xref="GeneID:106091944"
     CDS             128..523
                     /gene="LOC106091944"
                     /codon_start=1
                     /product="B-cell CLL/lymphoma 7 protein family member B"
                     /protein_id="XP_013114111.1"
                     /db_xref="GeneID:106091944"
                     /translation="MSRSVRAETRSRAKDDIKRVMQAVDKPRHWEKKWVTINDTTMKI
                     FKWVPISNNDKKKLNSLSKSDKENMQKGTPTPPQITSSYGLTADDSNTCFSVVSDSQG
                     ADFVSSMPFSEDSNSQGSEGPVKRIKTSD"
     misc_feature    131..274
                     /gene="LOC106091944"
                     /note="BCL7, N-terminal conserver region; Region: BCL_N;
                     pfam04714"
                     /db_xref="CDD:461406"
     polyA_site      689
                     /gene="LOC106091944"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cagtgaactg tcaagctgca accaccgaaa attgctaaat attccggcct ttggtttagc
       61 aaaaaaagaa ataaataaat aacgttgtta aattacttca actaaggcaa ttcctcctac
      121 ttgaataatg tcacgcagtg ttcgagctga aactcgtagc cgagcaaagg atgatattaa
      181 gcgtgtaatg caagccgttg acaagccacg acattgggaa aagaaatggg ttactataaa
      241 tgataccaca atgaaaattt tcaaatgggt gcccatctcc aacaacgaca agaagaaact
      301 caatagtctg agcaaaagtg ataaggaaaa tatgcaaaaa ggcactccaa cacctcccca
      361 gataacgtcg agttatggat taacggccga tgattccaat acctgctttt cagtggttag
      421 tgattctcag ggtgctgatt tcgtgagcag tatgccattt tctgaagatt ctaactcaca
      481 gggcagcgag ggaccagtca aacgaataaa aacatccgat taaagcagta tccatatgta
      541 caaaaacaac tttttaaaca aacatttttc tcagtaattt taagttagta attttacatg
      601 tatagtaagt agaatatgac caacttaatt tcaatgattt caatatagtg atccctttac
      661 tcaaaacagc tttgacagaa tttcaacaa