Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013258657 689 bp mRNA linear INV 02-SEP-2023 member B (LOC106091944), mRNA. ACCESSION XM_013258657 VERSION XM_013258657.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013258657.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..689 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..689 /gene="LOC106091944" /note="B-cell CLL/lymphoma 7 protein family member B; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 Proteins" /db_xref="GeneID:106091944" CDS 128..523 /gene="LOC106091944" /codon_start=1 /product="B-cell CLL/lymphoma 7 protein family member B" /protein_id="XP_013114111.1" /db_xref="GeneID:106091944" /translation="MSRSVRAETRSRAKDDIKRVMQAVDKPRHWEKKWVTINDTTMKI FKWVPISNNDKKKLNSLSKSDKENMQKGTPTPPQITSSYGLTADDSNTCFSVVSDSQG ADFVSSMPFSEDSNSQGSEGPVKRIKTSD" misc_feature 131..274 /gene="LOC106091944" /note="BCL7, N-terminal conserver region; Region: BCL_N; pfam04714" /db_xref="CDD:461406" polyA_site 689 /gene="LOC106091944" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cagtgaactg tcaagctgca accaccgaaa attgctaaat attccggcct ttggtttagc 61 aaaaaaagaa ataaataaat aacgttgtta aattacttca actaaggcaa ttcctcctac 121 ttgaataatg tcacgcagtg ttcgagctga aactcgtagc cgagcaaagg atgatattaa 181 gcgtgtaatg caagccgttg acaagccacg acattgggaa aagaaatggg ttactataaa 241 tgataccaca atgaaaattt tcaaatgggt gcccatctcc aacaacgaca agaagaaact 301 caatagtctg agcaaaagtg ataaggaaaa tatgcaaaaa ggcactccaa cacctcccca 361 gataacgtcg agttatggat taacggccga tgattccaat acctgctttt cagtggttag 421 tgattctcag ggtgctgatt tcgtgagcag tatgccattt tctgaagatt ctaactcaca 481 gggcagcgag ggaccagtca aacgaataaa aacatccgat taaagcagta tccatatgta 541 caaaaacaac tttttaaaca aacatttttc tcagtaattt taagttagta attttacatg 601 tatagtaagt agaatatgac caacttaatt tcaatgattt caatatagtg atccctttac 661 tcaaaacagc tttgacagaa tttcaacaa