PREDICTED: Stomoxys calcitrans molybdopterin synthase sulfur

LOCUS       XM_013258655             378 bp    mRNA    linear   INV 02-SEP-2023
            carrier subunit (LOC106091942), mRNA.
ACCESSION   XM_013258655
VERSION     XM_013258655.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013258655.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..378
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..378
                     /gene="LOC106091942"
                     /note="molybdopterin synthase sulfur carrier subunit;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 4 Proteins"
                     /db_xref="GeneID:106091942"
     CDS             91..378
                     /gene="LOC106091942"
                     /codon_start=1
                     /product="molybdopterin synthase sulfur carrier subunit"
                     /protein_id="XP_013114109.1"
                     /db_xref="GeneID:106091942"
                     /translation="MSCGDSVPRKINIRILFFAKSRELSGVSEASFCLDTDNISSLEL
                     LNTISRLYNLESIKSTIVLAINQIYCDTESGEQLNLKEGDEIAIIPPLSGG"
     misc_feature    118..375
                     /gene="LOC106091942"
                     /note="first ubiquitin-like (Ubl) domain located at the
                     N-terminus of coronavirus SARS-CoV non-structural protein
                     3 (Nsp3) and related proteins; Region:
                     Ubl1_cv_Nsp3_N-like; cl28922"
                     /db_xref="CDD:475130"
     misc_feature    order(142..147,265..267,271..276,280..282,289..300,
                     355..375)
                     /gene="LOC106091942"
                     /note="MoaD-MoeB interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:340452"
     misc_feature    order(142..147,286..294,343..345,358..375)
                     /gene="LOC106091942"
                     /note="MoaD-MoaE interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:340452"
     misc_feature    order(142..147,289..294,361..375)
                     /gene="LOC106091942"
                     /note="heterodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:340452"
     misc_feature    373..375
                     /gene="LOC106091942"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:340452"
ORIGIN      
        1 gatcaatgct gtgcaggtgt aggtacaata gtaattattt tattttgatt agaattccat
       61 taacagcatg cttagttaga atttgccagt atgagctgtg gtgattccgt gccccgaaaa
      121 attaatattc gaatattgtt ttttgcaaaa tcacgtgaat tatctggagt aagtgaggct
      181 tcgttttgct tggatacaga taacatttct tcgcttgaat tgttgaacac aattagccga
      241 ctatataatt tggaatcaat taaatccacc attgtgttgg ccataaacca aatatattgt
      301 gacactgagt ctggagagca attaaatttg aaggagggcg atgaaattgc cattattcct
      361 cctttaagcg gcggctaa