Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013258654 574 bp mRNA linear INV 02-SEP-2023 subunit 1-like (LOC106091941), mRNA. ACCESSION XM_013258654 VERSION XM_013258654.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013258654.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..574 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..574 /gene="LOC106091941" /note="molybdopterin synthase catalytic subunit 1-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins" /db_xref="GeneID:106091941" CDS 1..459 /gene="LOC106091941" /codon_start=1 /product="molybdopterin synthase catalytic subunit 1-like" /protein_id="XP_013114108.2" /db_xref="GeneID:106091941" /translation="MSNHLLLTHEILDVGAISNLVSAGSCGAISLFVGTTRDNFEDKT VVSLEYEAYEPMALKEMESICSQLRQRWPDIVNIAIYHRLGLVPVSEASVVIAISSPH RKTSLEAVSMAIEDLKKHVPIWKKEKYDDDEGMWKENKECKWQTKEKEEI" polyA_site 574 /gene="LOC106091941" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 atgagcaacc acttgttact tacacatgaa attctcgatg tgggagccat tagcaatttg 61 gtatctgcag gcagctgtgg tgctatatct ctgtttgtgg ggaccacacg cgataacttt 121 gaggataaga cagtagtatc attggagtat gaagcctatg aacctatggc attgaaagaa 181 atggaaagta tatgtagcca attgaggcaa cgttggccgg acattgttaa tattgctata 241 tatcatcgtt tgggcctagt tcccgttagt gaagccagtg ttgtcatagc catatcttcg 301 ccgcatcgaa aaacatcttt ggaagcagtt tcaatggcta ttgaagatct taaaaagcat 361 gtgcccattt ggaaaaaaga aaaatatgat gatgatgaag gcatgtggaa ggaaaacaaa 421 gaatgcaaat ggcaaaccaa agaaaaggaa gagatataac agtatgtata tatacataca 481 tgggtgatgt attgcaaact tgtttttttt tatagctcga attgttgtat ttgttctaaa 541 gtcttgtttt gtgcaataaa tattcttata ctaa