Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans molybdopterin synthase catalytic


LOCUS       XM_013258654             574 bp    mRNA    linear   INV 02-SEP-2023
            subunit 1-like (LOC106091941), mRNA.
ACCESSION   XM_013258654
VERSION     XM_013258654.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013258654.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..574
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..574
                     /gene="LOC106091941"
                     /note="molybdopterin synthase catalytic subunit 1-like;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 6 Proteins"
                     /db_xref="GeneID:106091941"
     CDS             1..459
                     /gene="LOC106091941"
                     /codon_start=1
                     /product="molybdopterin synthase catalytic subunit 1-like"
                     /protein_id="XP_013114108.2"
                     /db_xref="GeneID:106091941"
                     /translation="MSNHLLLTHEILDVGAISNLVSAGSCGAISLFVGTTRDNFEDKT
                     VVSLEYEAYEPMALKEMESICSQLRQRWPDIVNIAIYHRLGLVPVSEASVVIAISSPH
                     RKTSLEAVSMAIEDLKKHVPIWKKEKYDDDEGMWKENKECKWQTKEKEEI"
     polyA_site      574
                     /gene="LOC106091941"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 atgagcaacc acttgttact tacacatgaa attctcgatg tgggagccat tagcaatttg
       61 gtatctgcag gcagctgtgg tgctatatct ctgtttgtgg ggaccacacg cgataacttt
      121 gaggataaga cagtagtatc attggagtat gaagcctatg aacctatggc attgaaagaa
      181 atggaaagta tatgtagcca attgaggcaa cgttggccgg acattgttaa tattgctata
      241 tatcatcgtt tgggcctagt tcccgttagt gaagccagtg ttgtcatagc catatcttcg
      301 ccgcatcgaa aaacatcttt ggaagcagtt tcaatggcta ttgaagatct taaaaagcat
      361 gtgcccattt ggaaaaaaga aaaatatgat gatgatgaag gcatgtggaa ggaaaacaaa
      421 gaatgcaaat ggcaaaccaa agaaaaggaa gagatataac agtatgtata tatacataca
      481 tgggtgatgt attgcaaact tgtttttttt tatagctcga attgttgtat ttgttctaaa
      541 gtcttgtttt gtgcaataaa tattcttata ctaa