Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013258533 432 bp mRNA linear INV 02-SEP-2023 ACCESSION XM_013258533 VERSION XM_013258533.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013258533.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..432 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..432 /gene="LOC106091852" /note="ctenidin-3; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:106091852" CDS 72..326 /gene="LOC106091852" /codon_start=1 /product="ctenidin-3" /protein_id="XP_013113987.1" /db_xref="GeneID:106091852" /translation="MKVLIVLCALLAVASAGFIGGYGGGWNSGWHGGYSSYPRVVKVI RLGGGGWSGGGYGGGSYGSGYIGGGYHGGYYGGGGHGGWW" ORIGIN 1 tcagcgaaac accaaagcat cctgtagacg aacctgagca ttttcgtata aaccgaatta 61 tagcagcagc catgaaagta ttgattgtcc tttgcgctct gttggcagta gcttcagccg 121 gatttatagg cggctatggt ggtggttgga attcaggctg gcatggtgga tattcctctt 181 atcccagagt ggtaaaagtg atacgccttg gtggcggtgg atggagcggt ggcggttatg 241 gaggtggcag ttatggaagt ggctacattg gcggtggcta tcatggtggc tactatggcg 301 gaggaggtca tgggggatgg tggtgaaaaa agtacgcact gagcaattcc ttcatgtgtt 361 aacacgtgaa cttattttaa cttcagtttg aatgtaaagt aaatgtaaat ttgtgattct 421 tcttgttcta tg