Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans ctenidin-3 (LOC106091852), mRNA.


LOCUS       XM_013258533             432 bp    mRNA    linear   INV 02-SEP-2023
ACCESSION   XM_013258533
VERSION     XM_013258533.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013258533.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..432
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..432
                     /gene="LOC106091852"
                     /note="ctenidin-3; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 4 Proteins"
                     /db_xref="GeneID:106091852"
     CDS             72..326
                     /gene="LOC106091852"
                     /codon_start=1
                     /product="ctenidin-3"
                     /protein_id="XP_013113987.1"
                     /db_xref="GeneID:106091852"
                     /translation="MKVLIVLCALLAVASAGFIGGYGGGWNSGWHGGYSSYPRVVKVI
                     RLGGGGWSGGGYGGGSYGSGYIGGGYHGGYYGGGGHGGWW"
ORIGIN      
        1 tcagcgaaac accaaagcat cctgtagacg aacctgagca ttttcgtata aaccgaatta
       61 tagcagcagc catgaaagta ttgattgtcc tttgcgctct gttggcagta gcttcagccg
      121 gatttatagg cggctatggt ggtggttgga attcaggctg gcatggtgga tattcctctt
      181 atcccagagt ggtaaaagtg atacgccttg gtggcggtgg atggagcggt ggcggttatg
      241 gaggtggcag ttatggaagt ggctacattg gcggtggcta tcatggtggc tactatggcg
      301 gaggaggtca tgggggatgg tggtgaaaaa agtacgcact gagcaattcc ttcatgtgtt
      361 aacacgtgaa cttattttaa cttcagtttg aatgtaaagt aaatgtaaat ttgtgattct
      421 tcttgttcta tg