Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013258527 950 bp mRNA linear INV 02-SEP-2023 (LOC106091845), mRNA. ACCESSION XM_013258527 VERSION XM_013258527.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013258527.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..950 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..950 /gene="LOC106091845" /note="uncharacterized LOC106091845; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106091845" CDS 117..767 /gene="LOC106091845" /codon_start=1 /product="uncharacterized protein LOC106091845" /protein_id="XP_013113981.2" /db_xref="GeneID:106091845" /translation="MRLFVILFVAVFAVSVSAGFLGGGGGGGGGYGGGGGNPWAGKQG GGGGGFGGGGSYGGGGHGGGGGNPWAGKQGGFGGGYGGGFGGGHGGGSGGGFGSNPWA NKQGGGGGFGGNHGGGGGYGGSGGFGGRHGGGGGYGGSGGFGGKHGGGGGGGYGGSGG FGGRHGGGGGFGGSGGYGGGRHGGGGFGGSGGWQNKQGGGGFGGSGGWQNKHGGSW" polyA_site 950 /gene="LOC106091845" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gcgaatttgt catcttcagt tcacttcaat tcttgagatc gatttgaaaa caatagagct 61 caaacatctt gggattttcg acgttttaag ttaaaaaaaa tattgctttt gacaaaatgc 121 gtttgtttgt gattttattc gtggctgttt ttgctgtgtc ggtgtcggct ggattccttg 181 gcggtggtgg aggtggaggt ggtggttatg gaggcggcgg tggtaatcct tgggctggca 241 aacaaggtgg tggcggtgga ggcttcggcg gtggtggaag ctatggtggt ggtggccatg 301 gcggcggtgg tggcaaccct tgggctggaa agcaaggagg ctttggtggc ggctatggcg 361 gtggattcgg tggaggtcat ggaggtggtt cgggtggagg atttggttca aacccttggg 421 ctaataaaca aggcggcggc ggcggctttg gtggcaatca tggcggtggt ggtggatacg 481 gaggatcggg cggttttggt ggacgtcatg gaggcggtgg tggatatgga ggttccggcg 541 gttttggtgg aaaacacggt ggcggcggag gtggtggtta tggtggctca ggaggctttg 601 gtggtagaca tggaggtggt ggtggctttg gaggttccgg cggctatggt ggtggtagac 661 acggtggtgg cggttttgga ggatctggcg gttggcaaaa caagcaggga ggtggaggct 721 ttggaggatc tggtggctgg caaaacaaac acggaggttc ctggtgaaac ctcaaaaatc 781 tcaatttagt gttgtatttc attgcaaaca tcttttggac tttattttac aagcaaaact 841 gctgtgttcc attacttaat gtgttccata ttttttctat taacggtatt agccaaaagt 901 tgagcaaaaa tatgtaaatc ttttcacaat ataaatatca acatacaata