Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106091845


LOCUS       XM_013258527             950 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106091845), mRNA.
ACCESSION   XM_013258527
VERSION     XM_013258527.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013258527.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..950
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..950
                     /gene="LOC106091845"
                     /note="uncharacterized LOC106091845; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:106091845"
     CDS             117..767
                     /gene="LOC106091845"
                     /codon_start=1
                     /product="uncharacterized protein LOC106091845"
                     /protein_id="XP_013113981.2"
                     /db_xref="GeneID:106091845"
                     /translation="MRLFVILFVAVFAVSVSAGFLGGGGGGGGGYGGGGGNPWAGKQG
                     GGGGGFGGGGSYGGGGHGGGGGNPWAGKQGGFGGGYGGGFGGGHGGGSGGGFGSNPWA
                     NKQGGGGGFGGNHGGGGGYGGSGGFGGRHGGGGGYGGSGGFGGKHGGGGGGGYGGSGG
                     FGGRHGGGGGFGGSGGYGGGRHGGGGFGGSGGWQNKQGGGGFGGSGGWQNKHGGSW"
     polyA_site      950
                     /gene="LOC106091845"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gcgaatttgt catcttcagt tcacttcaat tcttgagatc gatttgaaaa caatagagct
       61 caaacatctt gggattttcg acgttttaag ttaaaaaaaa tattgctttt gacaaaatgc
      121 gtttgtttgt gattttattc gtggctgttt ttgctgtgtc ggtgtcggct ggattccttg
      181 gcggtggtgg aggtggaggt ggtggttatg gaggcggcgg tggtaatcct tgggctggca
      241 aacaaggtgg tggcggtgga ggcttcggcg gtggtggaag ctatggtggt ggtggccatg
      301 gcggcggtgg tggcaaccct tgggctggaa agcaaggagg ctttggtggc ggctatggcg
      361 gtggattcgg tggaggtcat ggaggtggtt cgggtggagg atttggttca aacccttggg
      421 ctaataaaca aggcggcggc ggcggctttg gtggcaatca tggcggtggt ggtggatacg
      481 gaggatcggg cggttttggt ggacgtcatg gaggcggtgg tggatatgga ggttccggcg
      541 gttttggtgg aaaacacggt ggcggcggag gtggtggtta tggtggctca ggaggctttg
      601 gtggtagaca tggaggtggt ggtggctttg gaggttccgg cggctatggt ggtggtagac
      661 acggtggtgg cggttttgga ggatctggcg gttggcaaaa caagcaggga ggtggaggct
      721 ttggaggatc tggtggctgg caaaacaaac acggaggttc ctggtgaaac ctcaaaaatc
      781 tcaatttagt gttgtatttc attgcaaaca tcttttggac tttattttac aagcaaaact
      841 gctgtgttcc attacttaat gtgttccata ttttttctat taacggtatt agccaaaagt
      901 tgagcaaaaa tatgtaaatc ttttcacaat ataaatatca acatacaata