PREDICTED: Stomoxys calcitrans uncharacterized transmembrane

LOCUS       XM_013258526             759 bp    mRNA    linear   INV 02-SEP-2023
            protein DDB_G0289901-like (LOC106091844), mRNA.
ACCESSION   XM_013258526
VERSION     XM_013258526.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013258526.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..759
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..759
                     /gene="LOC106091844"
                     /note="uncharacterized transmembrane protein
                     DDB_G0289901-like; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 1 Protein"
                     /db_xref="GeneID:106091844"
     CDS             1..759
                     /gene="LOC106091844"
                     /codon_start=1
                     /product="uncharacterized transmembrane protein
                     DDB_G0289901-like"
                     /protein_id="XP_013113980.2"
                     /db_xref="GeneID:106091844"
                     /translation="MKLYILVLLLGLSAQVLAGHLGGAAWQGASSGWQHGGQGAWSSN
                     AGSGGGWTQNHGNDGWSSGGASVAATPVKVVKIISLDDAGHGGWNGGNSGWSSNAGND
                     GWKTGGGSTAAWSSTTSTVWPDSSSGSKGWSSTSAWPSAGGDSGPGAVWNKRPNDASA
                     WKAGGGNSGWYQGGNGAAWTQEANDAAAWKTEAGNDGWSQAGNAGAWKSDGGNAGWSQ
                     GSSSGILKADNGNAGWSSGGNKGWSSGGNQAWKW"
ORIGIN      
        1 atgaaacttt acatccttgt tctgctgttg ggtttgagtg ctcaagtttt ggctggtcat
       61 ctgggtgggg ctgcttggca aggagcttcc agtggttggc aacatggtgg ccaaggagca
      121 tggtcttcta atgctggatc tggaggaggt tggacccaaa atcatggcaa cgatggatgg
      181 tccagtggtg gtgctagcgt tgctgctact cctgtcaaag tggtaaaaat catttctttg
      241 gatgatgctg gtcatggtgg ttggaatggg ggtaatagtg gctggtcttc aaatgctggc
      301 aatgacggtt ggaaaactgg tggtggaagc acagctgctt ggtcttccac gaccagtaca
      361 gtttggcccg actctagcag cggcagcaaa ggttggtctt cgaccagtgc ttggccatct
      421 gcaggtggag atagtggacc aggagctgtt tggaacaaga gacccaatga tgcatcagct
      481 tggaaagctg gaggtggaaa ctctggatgg tatcaaggcg gtaatggtgc tgcctggact
      541 caagaggcca atgatgcagc tgcttggaaa accgaagctg gaaatgatgg ttggtctcaa
      601 gctggtaatg ctggtgcttg gaaatccgat ggagggaatg ctggatggtc tcagggtagc
      661 agctctggta ttttgaaggc agataatgga aacgctggct ggtcttctgg tggcaataaa
      721 ggctggtcgt caggtggtaa tcaagcctgg aaatggtag