Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013258462 1008 bp mRNA linear INV 02-SEP-2023 (LOC106091800), partial mRNA. ACCESSION XM_013258462 VERSION XM_013258462.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013258462.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 3% of CDS bases ##RefSeq-Attributes-END## COMPLETENESS: incomplete on the 5' end. FEATURES Location/Qualifiers source 1..1008 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene <1..1008 /gene="LOC106091800" /note="uncharacterized LOC106091800; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106091800" CDS <1..786 /gene="LOC106091800" /codon_start=1 /product="uncharacterized protein LOC106091800" /protein_id="XP_013113916.2" /db_xref="GeneID:106091800" /translation="YLSRTFTYISTTTPIHTCCTQTGSSLKPGPELNIFSAGSSNPTL NTHAYINHNGNGANSNGGGGGGGNGSPNGGGNGQNGGSNNGGNGNNPAIIDPHYVFGA PQSVPILPNLPIFPYNSPTVAPAFQQFPQPNHPGSVLNPGRPQNGMQPLNPYNSPFVF GQQPFYNAPGGTGGPPGGSSGILGGSGGGLAPYPGGYPSPNSYNKPPPQYQNQNPYNR QTQTHAHSGSITMHGSMASAVCKLTLTLTVVGVLLGKMMHIST" polyA_site 1008 /gene="LOC106091800" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tatctatcgc gtacattcac atatatttcc accaccacac ccattcacac atgttgcacc 61 caaacaggat caagtcttaa gcctggtccc gaacttaaca tattctcggc gggctcatcc 121 aatcccacgc taaacactca tgcttatatc aatcacaatg gcaacggtgc caactctaat 181 ggtggcggag gcggtggcgg caatgggtca ccgaatggcg gtggcaatgg ccaaaatggg 241 ggctccaaca atggtggcaa tggcaacaat ccggcgatta ttgatcccca ctatgtgttt 301 ggggcgccac agtcggtgcc cattttgccc aatctgccca tattccccta taactcacca 361 actgtagcac ctgcttttca acaatttcct caacccaatc atccaggtag cgtacttaat 421 cccggccgtc cccaaaatgg catgcagccg ctgaatccct acaactcgcc cttcgtcttt 481 ggtcaacagc ccttctacaa tgcaccaggc ggtactggcg gcccacccgg cggcagcagt 541 ggcatcttgg gcggcagcgg cggtggcttg gccccttatc caggcggcta tccaagtccc 601 aatagttata acaaaccccc accacaatat caaaatcaga atccctacaa tcgtcagaca 661 cagacgcatg cccacagtgg cagcattacg atgcatggtt ccatggcaag cgccgtttgt 721 aaattgaccc tgactctcac cgtggtggga gtattgcttg gcaaaatgat gcacatcagc 781 acgtaatatt tttaatatat tttttctttt tatttccttt cacattggtt gttattttga 841 gctaattatt tgaattttgt taaaattata tagagaaaca gaaaatgaaa cgaaacacga 901 aacacaaaac acgtgaaaac gataactacc acaaaaaaaa gctgaatatt atacatacta 961 caaaaaaaaa taaatatttt ttttctcagt tacgagtttc aattttaa