Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106091800


LOCUS       XM_013258462            1008 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106091800), partial mRNA.
ACCESSION   XM_013258462
VERSION     XM_013258462.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013258462.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 3% of CDS bases
            ##RefSeq-Attributes-END##
            COMPLETENESS: incomplete on the 5' end.
FEATURES             Location/Qualifiers
     source          1..1008
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            <1..1008
                     /gene="LOC106091800"
                     /note="uncharacterized LOC106091800; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:106091800"
     CDS             <1..786
                     /gene="LOC106091800"
                     /codon_start=1
                     /product="uncharacterized protein LOC106091800"
                     /protein_id="XP_013113916.2"
                     /db_xref="GeneID:106091800"
                     /translation="YLSRTFTYISTTTPIHTCCTQTGSSLKPGPELNIFSAGSSNPTL
                     NTHAYINHNGNGANSNGGGGGGGNGSPNGGGNGQNGGSNNGGNGNNPAIIDPHYVFGA
                     PQSVPILPNLPIFPYNSPTVAPAFQQFPQPNHPGSVLNPGRPQNGMQPLNPYNSPFVF
                     GQQPFYNAPGGTGGPPGGSSGILGGSGGGLAPYPGGYPSPNSYNKPPPQYQNQNPYNR
                     QTQTHAHSGSITMHGSMASAVCKLTLTLTVVGVLLGKMMHIST"
     polyA_site      1008
                     /gene="LOC106091800"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tatctatcgc gtacattcac atatatttcc accaccacac ccattcacac atgttgcacc
       61 caaacaggat caagtcttaa gcctggtccc gaacttaaca tattctcggc gggctcatcc
      121 aatcccacgc taaacactca tgcttatatc aatcacaatg gcaacggtgc caactctaat
      181 ggtggcggag gcggtggcgg caatgggtca ccgaatggcg gtggcaatgg ccaaaatggg
      241 ggctccaaca atggtggcaa tggcaacaat ccggcgatta ttgatcccca ctatgtgttt
      301 ggggcgccac agtcggtgcc cattttgccc aatctgccca tattccccta taactcacca
      361 actgtagcac ctgcttttca acaatttcct caacccaatc atccaggtag cgtacttaat
      421 cccggccgtc cccaaaatgg catgcagccg ctgaatccct acaactcgcc cttcgtcttt
      481 ggtcaacagc ccttctacaa tgcaccaggc ggtactggcg gcccacccgg cggcagcagt
      541 ggcatcttgg gcggcagcgg cggtggcttg gccccttatc caggcggcta tccaagtccc
      601 aatagttata acaaaccccc accacaatat caaaatcaga atccctacaa tcgtcagaca
      661 cagacgcatg cccacagtgg cagcattacg atgcatggtt ccatggcaag cgccgtttgt
      721 aaattgaccc tgactctcac cgtggtggga gtattgcttg gcaaaatgat gcacatcagc
      781 acgtaatatt tttaatatat tttttctttt tatttccttt cacattggtt gttattttga
      841 gctaattatt tgaattttgt taaaattata tagagaaaca gaaaatgaaa cgaaacacga
      901 aacacaaaac acgtgaaaac gataactacc acaaaaaaaa gctgaatatt atacatacta
      961 caaaaaaaaa taaatatttt ttttctcagt tacgagtttc aattttaa