Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans farnesol dehydrogenase


LOCUS       XM_013258182             833 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106091620), mRNA.
ACCESSION   XM_013258182
VERSION     XM_013258182.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013258182.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..833
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..833
                     /gene="LOC106091620"
                     /note="farnesol dehydrogenase; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 6
                     Proteins"
                     /db_xref="GeneID:106091620"
     CDS             84..833
                     /gene="LOC106091620"
                     /codon_start=1
                     /product="farnesol dehydrogenase"
                     /protein_id="XP_013113636.1"
                     /db_xref="GeneID:106091620"
                     /translation="MERWQNKVAVVTGASSGIGEAIVKDLVRNGLQVIGLARRLDRME
                     NIKKQLPAQQQRYLTPMKCDISDSEAVNQVFDKIIAQFGGIDIMVNNAGCMKLGQLTT
                     MDAGVIQQVLQTNVMGVIYCTQRAFQSMKERNVAGHVIIINSIAGHGIVSMGNMLPET
                     NIYSPTKFALRAATEIYRQEFKGFGTKVKVTSISPGAVETEIIPDSFRSMIGENILRC
                     EDISSAALYAISTPPNVQIHEMIIKPVGEMF"
     misc_feature    84..815
                     /gene="LOC106091620"
                     /note="A large family of proteins that share a
                     Rossmann-fold NAD(P)H/NAD(P)(+) binding (NADB) domain. The
                     NADB domain is found in numerous dehydrogenases of
                     metabolic pathways such as glycolysis, and many other
                     redox enzymes. NAD binding involves numerous...; Region:
                     Rossmann-fold NAD(P)(+)-binding proteins; cl21454"
                     /db_xref="CDD:473865"
     misc_feature    order(120..122,126..131,135..137,192..200,354..362,
                     507..515,570..572,582..584,666..677)
                     /gene="LOC106091620"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(426..428,513..515,570..572,582..584)
                     /gene="LOC106091620"
                     /note="active site"
                     /db_xref="CDD:187535"
ORIGIN      
        1 acaacgctta gtttgaaaca aagcatcaaa taacacatat catcatataa acctgtgcga
       61 aacacttcag cgaaatttct ccaatggaac gttggcaaaa taaagtggct gtggtaacgg
      121 gagctagttc gggtattggg gaagccatag tgaaggattt ggtaaggaat ggcttgcaag
      181 ttattggctt ggcaaggaga ttggatcgca tggaaaatat caaaaagcaa ctaccagctc
      241 aacaacagag atatttgact cccatgaaat gtgatatttc ggatagtgaa gctgtaaatc
      301 aagtttttga taaaatcata gcccaatttg gaggtatcga cattatggtc aacaatgccg
      361 gttgcatgaa actgggccaa ttgaccacta tggatgctgg tgttattcaa caagttctgc
      421 aaaccaatgt catgggtgtt atctactgca ctcagagagc ttttcaatcc atgaaggagc
      481 gtaacgttgc tggccatgtc attatcatta atagtatagc tggccatggt atcgtgagta
      541 tgggaaatat gcttcccgaa actaacatct atagtcctac gaaatttgct ctaagggccg
      601 caactgagat ttaccgtcaa gagtttaagg gtttcggcac caaagtaaaa gtaactagca
      661 ttagtcctgg tgctgtggaa accgaaataa ttccagacag ctttcgatcc atgattggcg
      721 aaaatatttt aaggtgtgag gatatttcat ctgctgcttt gtatgcaatt tcaacacctc
      781 ccaatgttca gattcatgaa atgatcatca aacctgtggg ggagatgttt taa