Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013258182 833 bp mRNA linear INV 02-SEP-2023 (LOC106091620), mRNA. ACCESSION XM_013258182 VERSION XM_013258182.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013258182.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..833 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..833 /gene="LOC106091620" /note="farnesol dehydrogenase; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins" /db_xref="GeneID:106091620" CDS 84..833 /gene="LOC106091620" /codon_start=1 /product="farnesol dehydrogenase" /protein_id="XP_013113636.1" /db_xref="GeneID:106091620" /translation="MERWQNKVAVVTGASSGIGEAIVKDLVRNGLQVIGLARRLDRME NIKKQLPAQQQRYLTPMKCDISDSEAVNQVFDKIIAQFGGIDIMVNNAGCMKLGQLTT MDAGVIQQVLQTNVMGVIYCTQRAFQSMKERNVAGHVIIINSIAGHGIVSMGNMLPET NIYSPTKFALRAATEIYRQEFKGFGTKVKVTSISPGAVETEIIPDSFRSMIGENILRC EDISSAALYAISTPPNVQIHEMIIKPVGEMF" misc_feature 84..815 /gene="LOC106091620" /note="A large family of proteins that share a Rossmann-fold NAD(P)H/NAD(P)(+) binding (NADB) domain. The NADB domain is found in numerous dehydrogenases of metabolic pathways such as glycolysis, and many other redox enzymes. NAD binding involves numerous...; Region: Rossmann-fold NAD(P)(+)-binding proteins; cl21454" /db_xref="CDD:473865" misc_feature order(120..122,126..131,135..137,192..200,354..362, 507..515,570..572,582..584,666..677) /gene="LOC106091620" /note="NAD(P) binding site [chemical binding]; other site" /db_xref="CDD:187535" misc_feature order(426..428,513..515,570..572,582..584) /gene="LOC106091620" /note="active site" /db_xref="CDD:187535" ORIGIN 1 acaacgctta gtttgaaaca aagcatcaaa taacacatat catcatataa acctgtgcga 61 aacacttcag cgaaatttct ccaatggaac gttggcaaaa taaagtggct gtggtaacgg 121 gagctagttc gggtattggg gaagccatag tgaaggattt ggtaaggaat ggcttgcaag 181 ttattggctt ggcaaggaga ttggatcgca tggaaaatat caaaaagcaa ctaccagctc 241 aacaacagag atatttgact cccatgaaat gtgatatttc ggatagtgaa gctgtaaatc 301 aagtttttga taaaatcata gcccaatttg gaggtatcga cattatggtc aacaatgccg 361 gttgcatgaa actgggccaa ttgaccacta tggatgctgg tgttattcaa caagttctgc 421 aaaccaatgt catgggtgtt atctactgca ctcagagagc ttttcaatcc atgaaggagc 481 gtaacgttgc tggccatgtc attatcatta atagtatagc tggccatggt atcgtgagta 541 tgggaaatat gcttcccgaa actaacatct atagtcctac gaaatttgct ctaagggccg 601 caactgagat ttaccgtcaa gagtttaagg gtttcggcac caaagtaaaa gtaactagca 661 ttagtcctgg tgctgtggaa accgaaataa ttccagacag ctttcgatcc atgattggcg 721 aaaatatttt aaggtgtgag gatatttcat ctgctgcttt gtatgcaatt tcaacacctc 781 ccaatgttca gattcatgaa atgatcatca aacctgtggg ggagatgttt taa