Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013258113 936 bp mRNA linear INV 02-SEP-2023 (LOC106091563), mRNA. ACCESSION XM_013258113 VERSION XM_013258113.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013258113.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..936 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..936 /gene="LOC106091563" /note="uncharacterized LOC106091563; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 Proteins" /db_xref="GeneID:106091563" CDS 274..669 /gene="LOC106091563" /codon_start=1 /product="uncharacterized protein LOC106091563" /protein_id="XP_013113567.1" /db_xref="GeneID:106091563" /translation="MSHGDRGGRISVVKFLELGFAIACLALHFYSFDDRDIITSFLAT GTFSGYIVVVIGIFAGAMMRAHIHRRIDIFFSVLGCALFVASGIFIIEAWEYSFRTRT RDLALIKASLSIVNGVLFGFDAIFTFRDK" polyA_site 936 /gene="LOC106091563" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tatccgaagg cattacaatt ggctgccgtc agttgcggtt caccgatcgc gatgatcaaa 61 acattggtta cggaggttca tgttacaatc tgtcgttcaa taaactttaa actggcaact 121 atgtggatat tttaaaacaa cagaaacagc tcgaagtacc agaaaaaagg atatggataa 181 tatataaaaa gcgatttagc tatttgttac aaaagaagag gacgaacatt gataaaaaac 241 agtggccatt gcaaaggtta ccatccatac aaaatgtcac atggagaccg cggaggacga 301 ataagtgtgg tgaaattttt ggaattggga tttgccatag catgcctggc tttgcatttc 361 tatagtttcg atgatcggga cataataaca tcctttctgg cgactggaac cttcagtgga 421 tacattgtgg ttgtaattgg aatttttgct ggcgcaatga tgcgagccca catacatcgt 481 cgaatagata ttttcttcag cgtcttgggc tgcgccctgt ttgtggcctc tggtattttc 541 atcatcgagg cctgggagta ttcatttcgc acaaggacac gagatttggc cctgatcaag 601 gcctcattgt ccattgtgaa tggcgtgctg tttggattcg atgccatatt cacatttcgt 661 gataaataga gtcgaagaat taaaaaagaa aatgctgcca cacacacaaa acgaacccta 721 aaaccaaata aaatagacat ttcgtttttt ttctttttat acctacatac cttcttaaat 781 gtacaaccat aaatacacaa gtatgtatgt aagaataagt aaataaataa acaatctttc 841 agtctttttc taaagttggt ctatccatcc cttaattttg tttgattgta cagcaacatc 901 gtacatataa ggaccataat aaatcaattc gaataa