Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106091563


LOCUS       XM_013258113             936 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106091563), mRNA.
ACCESSION   XM_013258113
VERSION     XM_013258113.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013258113.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..936
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..936
                     /gene="LOC106091563"
                     /note="uncharacterized LOC106091563; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 9
                     Proteins"
                     /db_xref="GeneID:106091563"
     CDS             274..669
                     /gene="LOC106091563"
                     /codon_start=1
                     /product="uncharacterized protein LOC106091563"
                     /protein_id="XP_013113567.1"
                     /db_xref="GeneID:106091563"
                     /translation="MSHGDRGGRISVVKFLELGFAIACLALHFYSFDDRDIITSFLAT
                     GTFSGYIVVVIGIFAGAMMRAHIHRRIDIFFSVLGCALFVASGIFIIEAWEYSFRTRT
                     RDLALIKASLSIVNGVLFGFDAIFTFRDK"
     polyA_site      936
                     /gene="LOC106091563"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tatccgaagg cattacaatt ggctgccgtc agttgcggtt caccgatcgc gatgatcaaa
       61 acattggtta cggaggttca tgttacaatc tgtcgttcaa taaactttaa actggcaact
      121 atgtggatat tttaaaacaa cagaaacagc tcgaagtacc agaaaaaagg atatggataa
      181 tatataaaaa gcgatttagc tatttgttac aaaagaagag gacgaacatt gataaaaaac
      241 agtggccatt gcaaaggtta ccatccatac aaaatgtcac atggagaccg cggaggacga
      301 ataagtgtgg tgaaattttt ggaattggga tttgccatag catgcctggc tttgcatttc
      361 tatagtttcg atgatcggga cataataaca tcctttctgg cgactggaac cttcagtgga
      421 tacattgtgg ttgtaattgg aatttttgct ggcgcaatga tgcgagccca catacatcgt
      481 cgaatagata ttttcttcag cgtcttgggc tgcgccctgt ttgtggcctc tggtattttc
      541 atcatcgagg cctgggagta ttcatttcgc acaaggacac gagatttggc cctgatcaag
      601 gcctcattgt ccattgtgaa tggcgtgctg tttggattcg atgccatatt cacatttcgt
      661 gataaataga gtcgaagaat taaaaaagaa aatgctgcca cacacacaaa acgaacccta
      721 aaaccaaata aaatagacat ttcgtttttt ttctttttat acctacatac cttcttaaat
      781 gtacaaccat aaatacacaa gtatgtatgt aagaataagt aaataaataa acaatctttc
      841 agtctttttc taaagttggt ctatccatcc cttaattttg tttgattgta cagcaacatc
      901 gtacatataa ggaccataat aaatcaattc gaataa