Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans RING finger protein narya


LOCUS       XM_013258017            1017 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106091478), mRNA.
ACCESSION   XM_013258017
VERSION     XM_013258017.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013258017.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 8% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1017
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1017
                     /gene="LOC106091478"
                     /note="RING finger protein narya; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:106091478"
     CDS             127..1017
                     /gene="LOC106091478"
                     /codon_start=1
                     /product="RING finger protein narya"
                     /protein_id="XP_013113471.2"
                     /db_xref="GeneID:106091478"
                     /translation="MFPLFCNNCFRRQSLEPHLIFYVSSCAHVLCEECVQKCALCKKV
                     YKPYAINNETPWEIAEYFETPNKHSHKYSKILRFQYSQQLRLAKFEEMQHFEKMEQDL
                     LAETSSNESSGMQDMLKELLNIDKNEEQASAQIRQTGESNKHISRASKMEEQSKPSYR
                     RNGHRKSTSNFADLALHDSSSKSKNPVSMVSMMEEEQPETVCKHKRQETAEMRKQELN
                     ASMVKQEIRPRYEKDVRRANNPSSFSCGYTPYHPKSVSKCSTLTRAEGVMPADRGHGQ
                     KVLPSFLASPDRKKKKLTNF"
ORIGIN      
        1 taacacatgg gcggcaatgt tggcagcatc gtttaccgtt agtcttaaga caaatagctc
       61 tgcacctcgt ttttgaagta attggtcaag ttttctattt tatcggaaaa agcctttcga
      121 actaaaatgt ttcccttgtt ttgtaacaat tgctttcgac gccaatcgct cgagccgcac
      181 ctgatattct atgtttcaag ttgcgcccat gtgctttgcg aagaatgtgt ccagaagtgt
      241 gctctttgca aaaaagtcta caagccctat gccattaata atgaaacgcc ctgggaaata
      301 gccgaatatt ttgaaactcc caataagcac agccacaaat attcaaaaat cctaaggttc
      361 caatatagcc agcaactacg gctggccaaa tttgaggaaa tgcaacattt tgagaaaatg
      421 gaacaagatt tacttgcaga aacctcttcg aacgaatcaa gcggaatgca agatatgctg
      481 aaagaactat taaacattga caaaaatgaa gagcaagcaa gtgcacaaat tagacaaaca
      541 ggcgaatcta ataagcatat ttctagagca tccaagatgg aggagcagtc caagcctagt
      601 tatcgaagaa atggtcaccg gaaaagcacc agtaactttg cagatctggc actacatgat
      661 tcaagctcta aatcaaagaa ccctgtttca atggtgtcaa tgatggagga ggagcagccc
      721 gagactgttt gtaaacataa acgccaagaa accgccgaaa tgaggaaaca ggaattgaac
      781 gcgtctatgg taaagcaaga aattaggcct cgttacgaaa aagatgttcg tcgagcaaat
      841 aatccttcat cattttcatg tggctatact ccatatcatc ccaaatctgt ttccaaatgc
      901 agcactttaa ctagggccga gggagttatg ccagcagatc gaggccatgg tcagaaggtt
      961 ttgccgagtt ttttagccag cccggaccgc aaaaaaaaga aactaaccaa tttttaa