Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013258017 1017 bp mRNA linear INV 02-SEP-2023 (LOC106091478), mRNA. ACCESSION XM_013258017 VERSION XM_013258017.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013258017.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 8% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1017 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1017 /gene="LOC106091478" /note="RING finger protein narya; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106091478" CDS 127..1017 /gene="LOC106091478" /codon_start=1 /product="RING finger protein narya" /protein_id="XP_013113471.2" /db_xref="GeneID:106091478" /translation="MFPLFCNNCFRRQSLEPHLIFYVSSCAHVLCEECVQKCALCKKV YKPYAINNETPWEIAEYFETPNKHSHKYSKILRFQYSQQLRLAKFEEMQHFEKMEQDL LAETSSNESSGMQDMLKELLNIDKNEEQASAQIRQTGESNKHISRASKMEEQSKPSYR RNGHRKSTSNFADLALHDSSSKSKNPVSMVSMMEEEQPETVCKHKRQETAEMRKQELN ASMVKQEIRPRYEKDVRRANNPSSFSCGYTPYHPKSVSKCSTLTRAEGVMPADRGHGQ KVLPSFLASPDRKKKKLTNF" ORIGIN 1 taacacatgg gcggcaatgt tggcagcatc gtttaccgtt agtcttaaga caaatagctc 61 tgcacctcgt ttttgaagta attggtcaag ttttctattt tatcggaaaa agcctttcga 121 actaaaatgt ttcccttgtt ttgtaacaat tgctttcgac gccaatcgct cgagccgcac 181 ctgatattct atgtttcaag ttgcgcccat gtgctttgcg aagaatgtgt ccagaagtgt 241 gctctttgca aaaaagtcta caagccctat gccattaata atgaaacgcc ctgggaaata 301 gccgaatatt ttgaaactcc caataagcac agccacaaat attcaaaaat cctaaggttc 361 caatatagcc agcaactacg gctggccaaa tttgaggaaa tgcaacattt tgagaaaatg 421 gaacaagatt tacttgcaga aacctcttcg aacgaatcaa gcggaatgca agatatgctg 481 aaagaactat taaacattga caaaaatgaa gagcaagcaa gtgcacaaat tagacaaaca 541 ggcgaatcta ataagcatat ttctagagca tccaagatgg aggagcagtc caagcctagt 601 tatcgaagaa atggtcaccg gaaaagcacc agtaactttg cagatctggc actacatgat 661 tcaagctcta aatcaaagaa ccctgtttca atggtgtcaa tgatggagga ggagcagccc 721 gagactgttt gtaaacataa acgccaagaa accgccgaaa tgaggaaaca ggaattgaac 781 gcgtctatgg taaagcaaga aattaggcct cgttacgaaa aagatgttcg tcgagcaaat 841 aatccttcat cattttcatg tggctatact ccatatcatc ccaaatctgt ttccaaatgc 901 agcactttaa ctagggccga gggagttatg ccagcagatc gaggccatgg tcagaaggtt 961 ttgccgagtt ttttagccag cccggaccgc aaaaaaaaga aactaaccaa tttttaa