Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013257998 1086 bp mRNA linear INV 02-SEP-2023 (LOC106091470), mRNA. ACCESSION XM_013257998 VERSION XM_013257998.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013257998.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1086 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1086 /gene="LOC106091470" /note="uncharacterized LOC106091470; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:106091470" CDS 113..958 /gene="LOC106091470" /codon_start=1 /product="uncharacterized protein LOC106091470" /protein_id="XP_013113452.2" /db_xref="GeneID:106091470" /translation="MESKDNRSKDKRHKMKSHYRNKSKYCKTSSSSGPEPIRGYVDVV DSSDERFVDRNEWIKGRAQKVTSQVGYNHDLVDLNIEDEENEQMRAGDFKLMTQLPMS SGGHFKFSSEKQWEQAENESFLDNTEASEYFTLNLKLINVGLQTIPFYKRMDFSSSMF TNDQLNTMEKSAELAEKTYQNVLKEHIENPRIKINSASRKTNSAKSQKSQASNAKKPS TETPDELDELLNITTDQMSKASMQSGRNTPAAANPPATPGNNSTAPADNKDDIQQWLD NVLDE" polyA_site 1086 /gene="LOC106091470" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ccgctttgca ttttgaacat ctgttcgctc ttgtgttgcc tgtggcaata atcaaagccc 61 gttgcttcct gaaaaatact cctagttacg gccatataaa acgcaatcaa ttatggaaag 121 caaggacaat cgatctaagg acaaacgtca taaaatgaaa agccattacc gaaataagag 181 caaatattgt aaaacatcgt caagctctgg cccggaacca attagaggct atgtggatgt 241 tgttgattct agcgatgaac gatttgtgga tcgaaatgag tggataaaag gacgagcaca 301 aaaggtaaca tcacaagttg gatataatca cgacttggtc gatttgaaca tagaagatga 361 agagaatgaa caaatgaggg ctggggattt taaacttatg actcaacttc ccatgtcatc 421 gggaggacac tttaagttct catcggagaa acaatgggag caggcagaga atgagtcctt 481 tttggacaac accgaagcca gcgaatactt tacattgaat ctcaaattga ttaatgtggg 541 cctgcaaacc attcccttct acaaacgcat ggatttctca tcctctatgt ttactaatga 601 tcagcttaac actatggaaa agtcagcaga gctggccgag aaaacctatc aaaatgtttt 661 gaaagagcac attgaaaatc cacgaataaa aatcaattct gccagccgta aaaccaattc 721 cgccaaaagt caaaaatccc aagcatcaaa tgcaaagaag ccgtccactg aaactcctga 781 cgaattggat gaattactaa atattaccac ggatcaaatg tctaaggcta gtatgcagtc 841 gggacgtaat actcctgcgg ctgcgaatcc accggcgaca ccgggaaata attctacagc 901 accagcagac aacaaagatg acatacaaca atggttggac aatgttttgg atgaatgaag 961 gatttgcatt tacataaccg tgcatagact aagcaagaat atttttttca cgccatagaa 1021 accatatgct ttaagcttgt agaacaagaa ttttacatat gaatattaaa aaaatactgc 1081 aaggaa