Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106091470


LOCUS       XM_013257998            1086 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106091470), mRNA.
ACCESSION   XM_013257998
VERSION     XM_013257998.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013257998.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1086
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1086
                     /gene="LOC106091470"
                     /note="uncharacterized LOC106091470; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:106091470"
     CDS             113..958
                     /gene="LOC106091470"
                     /codon_start=1
                     /product="uncharacterized protein LOC106091470"
                     /protein_id="XP_013113452.2"
                     /db_xref="GeneID:106091470"
                     /translation="MESKDNRSKDKRHKMKSHYRNKSKYCKTSSSSGPEPIRGYVDVV
                     DSSDERFVDRNEWIKGRAQKVTSQVGYNHDLVDLNIEDEENEQMRAGDFKLMTQLPMS
                     SGGHFKFSSEKQWEQAENESFLDNTEASEYFTLNLKLINVGLQTIPFYKRMDFSSSMF
                     TNDQLNTMEKSAELAEKTYQNVLKEHIENPRIKINSASRKTNSAKSQKSQASNAKKPS
                     TETPDELDELLNITTDQMSKASMQSGRNTPAAANPPATPGNNSTAPADNKDDIQQWLD
                     NVLDE"
     polyA_site      1086
                     /gene="LOC106091470"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ccgctttgca ttttgaacat ctgttcgctc ttgtgttgcc tgtggcaata atcaaagccc
       61 gttgcttcct gaaaaatact cctagttacg gccatataaa acgcaatcaa ttatggaaag
      121 caaggacaat cgatctaagg acaaacgtca taaaatgaaa agccattacc gaaataagag
      181 caaatattgt aaaacatcgt caagctctgg cccggaacca attagaggct atgtggatgt
      241 tgttgattct agcgatgaac gatttgtgga tcgaaatgag tggataaaag gacgagcaca
      301 aaaggtaaca tcacaagttg gatataatca cgacttggtc gatttgaaca tagaagatga
      361 agagaatgaa caaatgaggg ctggggattt taaacttatg actcaacttc ccatgtcatc
      421 gggaggacac tttaagttct catcggagaa acaatgggag caggcagaga atgagtcctt
      481 tttggacaac accgaagcca gcgaatactt tacattgaat ctcaaattga ttaatgtggg
      541 cctgcaaacc attcccttct acaaacgcat ggatttctca tcctctatgt ttactaatga
      601 tcagcttaac actatggaaa agtcagcaga gctggccgag aaaacctatc aaaatgtttt
      661 gaaagagcac attgaaaatc cacgaataaa aatcaattct gccagccgta aaaccaattc
      721 cgccaaaagt caaaaatccc aagcatcaaa tgcaaagaag ccgtccactg aaactcctga
      781 cgaattggat gaattactaa atattaccac ggatcaaatg tctaaggcta gtatgcagtc
      841 gggacgtaat actcctgcgg ctgcgaatcc accggcgaca ccgggaaata attctacagc
      901 accagcagac aacaaagatg acatacaaca atggttggac aatgttttgg atgaatgaag
      961 gatttgcatt tacataaccg tgcatagact aagcaagaat atttttttca cgccatagaa
     1021 accatatgct ttaagcttgt agaacaagaa ttttacatat gaatattaaa aaaatactgc
     1081 aaggaa