Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013257860 1040 bp mRNA linear INV 02-SEP-2023 (LOC106091365), transcript variant X2, mRNA. ACCESSION XM_013257860 VERSION XM_013257860.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013257860.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1040 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1040 /gene="LOC106091365" /note="alpha-tocopherol transfer protein; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106091365" CDS 117..935 /gene="LOC106091365" /codon_start=1 /product="alpha-tocopherol transfer protein isoform X2" /protein_id="XP_013113314.2" /db_xref="GeneID:106091365" /translation="MNIYGDTEQEKIIDDLQKWFEENKKLPNKIDRIYLTRFYLRTSK NIEATKKLLEDNFALRSKYPNIFFNRDPESQETRNTADLAYIVPLPGQTPEKERVTLF KLKNTDPEKLHFVDDVKTLIMIYDYCLSMPDLEIQDIPYITEGPIQIIDMQGISMGHV TRTSPKILTVLLQYLQNFCPGTIKGIHLINCPMYVNMMFTVAKPFLKKQIIDVIHFHN DGLGTLCAYVPLELLPLEYGGKAGRLTKIADDILSGIQAKRDYIMDPNYWTIME" polyA_site 1040 /gene="LOC106091365" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cgtcagcgat tagcagccta tcgcattgca ttttagaaac aaccatctag acttgagttt 61 agtcatttct gaatcaaaca tttcttttgt tacaattaaa taaaaaaaaa attaatatga 121 atatctacgg tgatacagaa caagaaaaaa tcattgatga tctacaaaag tggtttgaag 181 aaaataaaaa attacccaac aaaattgatc gcatttactt aacacgtttc tatctacgta 241 cttcgaaaaa tattgaagcc accaaaaaac ttttggaaga taatttcgct ttgcgcagca 301 aatatcctaa tatatttttc aatcgtgatc cagagtcaca agaaactcgc aatacagcag 361 atttagcata tatagtgcca ttacctggac aaacgccaga aaaggagcgt gtaacacttt 421 tcaaattgaa gaatacagat ccggaaaagc tacattttgt ggacgatgtc aaaaccctta 481 taatgatcta cgattactgc ctatccatgc cagatctgga aatacaagac attccctaca 541 tcactgaggg tcccatacaa ataatcgata tgcaaggcat ctcaatgggt catgtgacac 601 gaacgtcacc taaaatttta acagtactgc tgcaatattt gcaaaatttt tgtcctggca 661 caataaaggg catacatctg atcaattgtc cgatgtatgt aaatatgatg tttacggtgg 721 ccaaaccatt tttgaaaaag caaataatcg atgtgattca ctttcacaat gatggtttgg 781 gtaccttgtg tgcttatgtc cccttggaat tgctgccttt ggaatatggt ggcaaggctg 841 gtaggctaac caaaattgct gatgacatct taagtggtat acaagccaaa agggattata 901 taatggaccc aaactattgg acaataatgg agtaataaaa atatttaatt ttcaagtaaa 961 gatgccacat tagaatctta ccatgggaag tgttattgaa caataaaata attttggtct 1021 aaagatcaaa attaaaacaa