Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans alpha-tocopherol transfer protein


LOCUS       XM_013257860            1040 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106091365), transcript variant X2, mRNA.
ACCESSION   XM_013257860
VERSION     XM_013257860.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013257860.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1040
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1040
                     /gene="LOC106091365"
                     /note="alpha-tocopherol transfer protein; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:106091365"
     CDS             117..935
                     /gene="LOC106091365"
                     /codon_start=1
                     /product="alpha-tocopherol transfer protein isoform X2"
                     /protein_id="XP_013113314.2"
                     /db_xref="GeneID:106091365"
                     /translation="MNIYGDTEQEKIIDDLQKWFEENKKLPNKIDRIYLTRFYLRTSK
                     NIEATKKLLEDNFALRSKYPNIFFNRDPESQETRNTADLAYIVPLPGQTPEKERVTLF
                     KLKNTDPEKLHFVDDVKTLIMIYDYCLSMPDLEIQDIPYITEGPIQIIDMQGISMGHV
                     TRTSPKILTVLLQYLQNFCPGTIKGIHLINCPMYVNMMFTVAKPFLKKQIIDVIHFHN
                     DGLGTLCAYVPLELLPLEYGGKAGRLTKIADDILSGIQAKRDYIMDPNYWTIME"
     polyA_site      1040
                     /gene="LOC106091365"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cgtcagcgat tagcagccta tcgcattgca ttttagaaac aaccatctag acttgagttt
       61 agtcatttct gaatcaaaca tttcttttgt tacaattaaa taaaaaaaaa attaatatga
      121 atatctacgg tgatacagaa caagaaaaaa tcattgatga tctacaaaag tggtttgaag
      181 aaaataaaaa attacccaac aaaattgatc gcatttactt aacacgtttc tatctacgta
      241 cttcgaaaaa tattgaagcc accaaaaaac ttttggaaga taatttcgct ttgcgcagca
      301 aatatcctaa tatatttttc aatcgtgatc cagagtcaca agaaactcgc aatacagcag
      361 atttagcata tatagtgcca ttacctggac aaacgccaga aaaggagcgt gtaacacttt
      421 tcaaattgaa gaatacagat ccggaaaagc tacattttgt ggacgatgtc aaaaccctta
      481 taatgatcta cgattactgc ctatccatgc cagatctgga aatacaagac attccctaca
      541 tcactgaggg tcccatacaa ataatcgata tgcaaggcat ctcaatgggt catgtgacac
      601 gaacgtcacc taaaatttta acagtactgc tgcaatattt gcaaaatttt tgtcctggca
      661 caataaaggg catacatctg atcaattgtc cgatgtatgt aaatatgatg tttacggtgg
      721 ccaaaccatt tttgaaaaag caaataatcg atgtgattca ctttcacaat gatggtttgg
      781 gtaccttgtg tgcttatgtc cccttggaat tgctgccttt ggaatatggt ggcaaggctg
      841 gtaggctaac caaaattgct gatgacatct taagtggtat acaagccaaa agggattata
      901 taatggaccc aaactattgg acaataatgg agtaataaaa atatttaatt ttcaagtaaa
      961 gatgccacat tagaatctta ccatgggaag tgttattgaa caataaaata attttggtct
     1021 aaagatcaaa attaaaacaa