Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans alpha-tocopherol transfer protein


LOCUS       XM_013257859            1058 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106091365), transcript variant X1, mRNA.
ACCESSION   XM_013257859
VERSION     XM_013257859.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013257859.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1058
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1058
                     /gene="LOC106091365"
                     /note="alpha-tocopherol transfer protein; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:106091365"
     CDS             117..953
                     /gene="LOC106091365"
                     /codon_start=1
                     /product="alpha-tocopherol transfer protein isoform X1"
                     /protein_id="XP_013113313.2"
                     /db_xref="GeneID:106091365"
                     /translation="MNIYGDTEQEKIIDDLQKWFEENKKLPNKIDRIYLTRFYLRTSK
                     NIEATKKLLEDNFALRSKYPNIFFNRDPESQETRNTADLASDSAFRYIVPLPGQTPEK
                     ERVTLFKLKNTDPEKLHFVDDVKTLIMIYDYCLSMPDLEIQDIPYITEGPIQIIDMQG
                     ISMGHVTRTSPKILTVLLQYLQNFCPGTIKGIHLINCPMYVNMMFTVAKPFLKKQIID
                     VIHFHNDGLGTLCAYVPLELLPLEYGGKAGRLTKIADDILSGIQAKRDYIMDPNYWTI
                     ME"
     polyA_site      1058
                     /gene="LOC106091365"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cgtcagcgat tagcagccta tcgcattgca ttttagaaac aaccatctag acttgagttt
       61 agtcatttct gaatcaaaca tttcttttgt tacaattaaa taaaaaaaaa attaatatga
      121 atatctacgg tgatacagaa caagaaaaaa tcattgatga tctacaaaag tggtttgaag
      181 aaaataaaaa attacccaac aaaattgatc gcatttactt aacacgtttc tatctacgta
      241 cttcgaaaaa tattgaagcc accaaaaaac ttttggaaga taatttcgct ttgcgcagca
      301 aatatcctaa tatatttttc aatcgtgatc cagagtcaca agaaactcgc aatacagcag
      361 atttagcttc agattctgct ttcagatata tagtgccatt acctggacaa acgccagaaa
      421 aggagcgtgt aacacttttc aaattgaaga atacagatcc ggaaaagcta cattttgtgg
      481 acgatgtcaa aacccttata atgatctacg attactgcct atccatgcca gatctggaaa
      541 tacaagacat tccctacatc actgagggtc ccatacaaat aatcgatatg caaggcatct
      601 caatgggtca tgtgacacga acgtcaccta aaattttaac agtactgctg caatatttgc
      661 aaaatttttg tcctggcaca ataaagggca tacatctgat caattgtccg atgtatgtaa
      721 atatgatgtt tacggtggcc aaaccatttt tgaaaaagca aataatcgat gtgattcact
      781 ttcacaatga tggtttgggt accttgtgtg cttatgtccc cttggaattg ctgcctttgg
      841 aatatggtgg caaggctggt aggctaacca aaattgctga tgacatctta agtggtatac
      901 aagccaaaag ggattatata atggacccaa actattggac aataatggag taataaaaat
      961 atttaatttt caagtaaaga tgccacatta gaatcttacc atgggaagtg ttattgaaca
     1021 ataaaataat tttggtctaa agatcaaaat taaaacaa