Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013257859 1058 bp mRNA linear INV 02-SEP-2023 (LOC106091365), transcript variant X1, mRNA. ACCESSION XM_013257859 VERSION XM_013257859.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013257859.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1058 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1058 /gene="LOC106091365" /note="alpha-tocopherol transfer protein; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106091365" CDS 117..953 /gene="LOC106091365" /codon_start=1 /product="alpha-tocopherol transfer protein isoform X1" /protein_id="XP_013113313.2" /db_xref="GeneID:106091365" /translation="MNIYGDTEQEKIIDDLQKWFEENKKLPNKIDRIYLTRFYLRTSK NIEATKKLLEDNFALRSKYPNIFFNRDPESQETRNTADLASDSAFRYIVPLPGQTPEK ERVTLFKLKNTDPEKLHFVDDVKTLIMIYDYCLSMPDLEIQDIPYITEGPIQIIDMQG ISMGHVTRTSPKILTVLLQYLQNFCPGTIKGIHLINCPMYVNMMFTVAKPFLKKQIID VIHFHNDGLGTLCAYVPLELLPLEYGGKAGRLTKIADDILSGIQAKRDYIMDPNYWTI ME" polyA_site 1058 /gene="LOC106091365" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cgtcagcgat tagcagccta tcgcattgca ttttagaaac aaccatctag acttgagttt 61 agtcatttct gaatcaaaca tttcttttgt tacaattaaa taaaaaaaaa attaatatga 121 atatctacgg tgatacagaa caagaaaaaa tcattgatga tctacaaaag tggtttgaag 181 aaaataaaaa attacccaac aaaattgatc gcatttactt aacacgtttc tatctacgta 241 cttcgaaaaa tattgaagcc accaaaaaac ttttggaaga taatttcgct ttgcgcagca 301 aatatcctaa tatatttttc aatcgtgatc cagagtcaca agaaactcgc aatacagcag 361 atttagcttc agattctgct ttcagatata tagtgccatt acctggacaa acgccagaaa 421 aggagcgtgt aacacttttc aaattgaaga atacagatcc ggaaaagcta cattttgtgg 481 acgatgtcaa aacccttata atgatctacg attactgcct atccatgcca gatctggaaa 541 tacaagacat tccctacatc actgagggtc ccatacaaat aatcgatatg caaggcatct 601 caatgggtca tgtgacacga acgtcaccta aaattttaac agtactgctg caatatttgc 661 aaaatttttg tcctggcaca ataaagggca tacatctgat caattgtccg atgtatgtaa 721 atatgatgtt tacggtggcc aaaccatttt tgaaaaagca aataatcgat gtgattcact 781 ttcacaatga tggtttgggt accttgtgtg cttatgtccc cttggaattg ctgcctttgg 841 aatatggtgg caaggctggt aggctaacca aaattgctga tgacatctta agtggtatac 901 aagccaaaag ggattatata atggacccaa actattggac aataatggag taataaaaat 961 atttaatttt caagtaaaga tgccacatta gaatcttacc atgggaagtg ttattgaaca 1021 ataaaataat tttggtctaa agatcaaaat taaaacaa