Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans alpha-tocopherol transfer


LOCUS       XM_013257852            1003 bp    mRNA    linear   INV 02-SEP-2023
            protein-like (LOC106091358), mRNA.
ACCESSION   XM_013257852
VERSION     XM_013257852.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013257852.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1003
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1003
                     /gene="LOC106091358"
                     /note="alpha-tocopherol transfer protein-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:106091358"
     CDS             49..864
                     /gene="LOC106091358"
                     /codon_start=1
                     /product="alpha-tocopherol transfer protein-like"
                     /protein_id="XP_013113306.2"
                     /db_xref="GeneID:106091358"
                     /translation="MYIYGDVEEEKAVDALQQWFEDNKKLPKKIDRTMLWRLYQRASK
                     DIEKTKKVIEVNYTLRLKNPQIFANRDPTDNDTNNTHEIAHIIPLRELTPSNAHVTVL
                     HFYNPEPQLVHFTEDIKTFTMVNDCRFCLPDVIVEDEKAKISDGAMLVIDMEGVSLKF
                     IMRFTFFTMNTLFKYLYLAYPDAMKAVHLINCPPFINKILALVKPFMSKELFAMITCH
                     IDGLDSLYEHIPRDMLPNEYGGKAGKLADLAEENKKLLLEKRDFLTDMSYWKL"
ORIGIN      
        1 cgaacataac tggccgcatt aagtaaaaga aaaataccat ttaaaagaat gtatatttat
       61 ggtgatgtgg aagaagaaaa ggccgtagat gccttgcaac aatggtttga agataataag
      121 aaattaccaa agaaaattga tcgcacaatg ctatggcgtc tttaccaaag agcatctaag
      181 gatattgaga aaaccaagaa ggtaatagaa gtcaattaca ctctgcgctt aaaaaatcct
      241 caaatttttg caaatcgtga tcctaccgat aatgatacca ataatacaca tgaaattgct
      301 catattattc ccttacggga attgacaccc tcaaatgctc atgtaacggt tctacatttc
      361 tataatccag aacctcaatt ggttcacttc acggaggaca tcaaaacctt taccatggtc
      421 aatgattgcc gcttctgctt gcccgatgtc atagttgaag atgaaaaagc taaaatttcc
      481 gatggcgcca tgttagttat cgatatggaa ggtgttagct taaaatttat aatgcgtttt
      541 acctttttca ccatgaatac tctcttcaag tatctgtatt tggcttatcc agatgccatg
      601 aaggcagtac atctaataaa ttgtccgcct tttataaaca aaattttggc tttggtaaag
      661 ccatttatga gcaaagaact atttgccatg attacttgtc acatagatgg tcttgatagt
      721 ctttacgagc atattccaag ggatatgttg cctaatgaat atggtggtaa agctggtaaa
      781 ttagccgact tagctgaaga gaataagaaa ctcttactgg agaaaaggga cttcttaacg
      841 gatatgagct attggaagct ataaaactag tagacagaat tggatgttat tatgcagttc
      901 ttttgaattt accaatgtaa tgaatggctg tagtaatggt attcgaaacc cttttgtgac
      961 ctgtatctag ttttaaggat tatatagaag tgacttgatt cta