Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013257852 1003 bp mRNA linear INV 02-SEP-2023 protein-like (LOC106091358), mRNA. ACCESSION XM_013257852 VERSION XM_013257852.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013257852.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1003 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1003 /gene="LOC106091358" /note="alpha-tocopherol transfer protein-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106091358" CDS 49..864 /gene="LOC106091358" /codon_start=1 /product="alpha-tocopherol transfer protein-like" /protein_id="XP_013113306.2" /db_xref="GeneID:106091358" /translation="MYIYGDVEEEKAVDALQQWFEDNKKLPKKIDRTMLWRLYQRASK DIEKTKKVIEVNYTLRLKNPQIFANRDPTDNDTNNTHEIAHIIPLRELTPSNAHVTVL HFYNPEPQLVHFTEDIKTFTMVNDCRFCLPDVIVEDEKAKISDGAMLVIDMEGVSLKF IMRFTFFTMNTLFKYLYLAYPDAMKAVHLINCPPFINKILALVKPFMSKELFAMITCH IDGLDSLYEHIPRDMLPNEYGGKAGKLADLAEENKKLLLEKRDFLTDMSYWKL" ORIGIN 1 cgaacataac tggccgcatt aagtaaaaga aaaataccat ttaaaagaat gtatatttat 61 ggtgatgtgg aagaagaaaa ggccgtagat gccttgcaac aatggtttga agataataag 121 aaattaccaa agaaaattga tcgcacaatg ctatggcgtc tttaccaaag agcatctaag 181 gatattgaga aaaccaagaa ggtaatagaa gtcaattaca ctctgcgctt aaaaaatcct 241 caaatttttg caaatcgtga tcctaccgat aatgatacca ataatacaca tgaaattgct 301 catattattc ccttacggga attgacaccc tcaaatgctc atgtaacggt tctacatttc 361 tataatccag aacctcaatt ggttcacttc acggaggaca tcaaaacctt taccatggtc 421 aatgattgcc gcttctgctt gcccgatgtc atagttgaag atgaaaaagc taaaatttcc 481 gatggcgcca tgttagttat cgatatggaa ggtgttagct taaaatttat aatgcgtttt 541 acctttttca ccatgaatac tctcttcaag tatctgtatt tggcttatcc agatgccatg 601 aaggcagtac atctaataaa ttgtccgcct tttataaaca aaattttggc tttggtaaag 661 ccatttatga gcaaagaact atttgccatg attacttgtc acatagatgg tcttgatagt 721 ctttacgagc atattccaag ggatatgttg cctaatgaat atggtggtaa agctggtaaa 781 ttagccgact tagctgaaga gaataagaaa ctcttactgg agaaaaggga cttcttaacg 841 gatatgagct attggaagct ataaaactag tagacagaat tggatgttat tatgcagttc 901 ttttgaattt accaatgtaa tgaatggctg tagtaatggt attcgaaacc cttttgtgac 961 ctgtatctag ttttaaggat tatatagaag tgacttgatt cta