Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106091357


LOCUS       XM_013257851            1148 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106091357), transcript variant X1, mRNA.
ACCESSION   XM_013257851
VERSION     XM_013257851.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013257851.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1148
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1148
                     /gene="LOC106091357"
                     /note="uncharacterized LOC106091357; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106091357"
     CDS             30..716
                     /gene="LOC106091357"
                     /codon_start=1
                     /product="uncharacterized protein LOC106091357 isoform X1"
                     /protein_id="XP_013113305.2"
                     /db_xref="GeneID:106091357"
                     /translation="MAKKLIEAGEIHIMDISKNVDNFGHIRNHLGKLKRLQKNKEKAN
                     KTCRIVMTKNQAFNFYKTNFQAVNNPMKVKKTKSVKISVTRKTGLDFHLYEILHDNKT
                     GDDNPLIFAPYTWDGREIIWTNENNRRRVNDIKLWSFILTQYEKQMKYSSIYLNAKVK
                     KYFLKILRFKLNVNFPEIDVGAIPIMKCINSMLMEALRIYRIFEGREEEISLWYYKFF
                     KRIFPNEFQN"
ORIGIN      
        1 tgaagcaaca ataatagtaa atcaacaaaa tggcaaaaaa attaattgag gctggtgaaa
       61 tacatatcat ggacattagt aaaaatgtgg acaatttcgg tcatattaga aaccatttgg
      121 gaaaattgaa acgactgcag aaaaataaag aaaaagctaa taaaacttgt agaattgtca
      181 tgaccaaaaa ccaagctttt aatttttaca aaacaaattt tcaagctgtg aataatccta
      241 tgaaagtgaa gaaaactaaa tcggtgaaaa taagtgtaac aaggaaaacc ggactcgatt
      301 ttcatcttta cgaaatactc catgataata aaacgggaga tgataatcca ttaatttttg
      361 ctccctatac ttgggatgga agggaaataa tttggacaaa tgaaaataat agacgcagag
      421 taaatgacat caaactttgg agttttatac tcacacaata tgagaaacaa atgaaatatt
      481 cttcaattta cctaaatgcc aaagtgaaga agtatttcct taagattcta cgttttaaat
      541 tgaatgtaaa ctttccggaa attgacgttg gcgccatacc aataatgaaa tgcattaaca
      601 gtatgctaat ggaagcttta cgaatctatc gaatatttga aggtagggaa gaagaaatct
      661 ctttgtggta ttataagttt tttaaaagaa tattcccaaa tgaatttcaa aactgaaaac
      721 tggccttaaa tatcaaaaaa tcagatgcaa acgaaatttt tttcaaaaag tatatttttc
      781 atttttaatt aaaataattg ttgattttat taaatgaaaa gaccatttta ttttataatt
      841 ttgtatattt ttttcgaaaa atttatgtaa tattggttaa catttgttaa caaaaatgca
      901 gttctaaaga ctattaaaaa tatagcttta attgaatgcc ttatatacta aacctgagct
      961 atatgatgct aggtaaagtg caaaatatac cattctatct ttttgacatt ttatgtacta
     1021 gatacaagtg aattaacttt tgtttttata acattttaat catggtttga agtaaatttt
     1081 aagttttgtt gctatcataa ttaaagaagt tagaaaattt atgttttgcc ctttatcccc
     1141 tgaggtta